prot_M-pyrifera_M_contig8368.19544.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A6H5L0V1_9PHAE (UBC core domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0V1_9PHAE) HSP 1 Score: 81.3 bits (199), Expect = 1.220e-18 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA Sbjct: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: D8LQX5_ECTSI (UBC core domain-containing protein (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQX5_ECTSI) HSP 1 Score: 81.3 bits (199), Expect = 1.370e-18 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA Sbjct: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A2R5GJC5_9STRA (Ubiquitin-conjugating enzyme E2 E2 n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GJC5_9STRA) HSP 1 Score: 77.0 bits (188), Expect = 5.990e-17 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 0 Query: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35 MA+KRINKELQDLGKDPPANCSAGPV DDL+HWQA Sbjct: 1 MAMKRINKELQDLGKDPPANCSAGPVNDDLFHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A835ZQ60_9STRA (Ubiquitin-conjugating enzyme e2-16kda, ubiquitin protein ligase n=2 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZQ60_9STRA) HSP 1 Score: 76.6 bits (187), Expect = 8.470e-17 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 0 Query: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35 MALKRINKELQDLGKDPPANCSAGP+ DDL+HWQA Sbjct: 1 MALKRINKELQDLGKDPPANCSAGPIGDDLFHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A0P1A4M0_PLAHL (Ubiquitin-conjugating enzyme e2-16 kDa n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0P1A4M0_PLAHL) HSP 1 Score: 75.9 bits (185), Expect = 9.030e-17 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 0 Query: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35 MALKRINKELQDLG+DPPANCSAGPV DDL+HWQA Sbjct: 1 MALKRINKELQDLGRDPPANCSAGPVGDDLFHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: W7TCU7_9STRA (Ubiquitin-conjugating enzyme n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TCU7_9STRA) HSP 1 Score: 75.9 bits (185), Expect = 1.100e-16 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 0 Query: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35 MALKRINKELQDLG+DPPANCSAGPV DDL+HWQA Sbjct: 1 MALKRINKELQDLGRDPPANCSAGPVGDDLFHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A7S2ZCR1_9RHOD (Hypothetical protein n=5 Tax=Rhodosorus marinus TaxID=101924 RepID=A0A7S2ZCR1_9RHOD) HSP 1 Score: 77.0 bits (188), Expect = 1.170e-16 Identity = 33/35 (94.29%), Postives = 33/35 (94.29%), Query Frame = 0 Query: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35 MALKRINKELQDLGKDPPANCSAGPV DD YHWQA Sbjct: 1 MALKRINKELQDLGKDPPANCSAGPVGDDFYHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A0G4EH01_VITBC (UBC core domain-containing protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4EH01_VITBC) HSP 1 Score: 75.9 bits (185), Expect = 1.700e-16 Identity = 31/35 (88.57%), Postives = 34/35 (97.14%), Query Frame = 0 Query: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35 MALKRINKELQDLGKDPPANCSAGP+ DD++HWQA Sbjct: 1 MALKRINKELQDLGKDPPANCSAGPIGDDMFHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: F0Y5R5_AURAN (Ubiquitin-conjugating enzyme n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y5R5_AURAN) HSP 1 Score: 75.9 bits (185), Expect = 1.950e-16 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 0 Query: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35 MALKRINKELQDLG+DPPANCSAGPV DDL+HWQA Sbjct: 1 MALKRINKELQDLGRDPPANCSAGPVGDDLFHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A0K8R6X2_IXORI (Putative effete n=1 Tax=Ixodes ricinus TaxID=34613 RepID=A0A0K8R6X2_IXORI) HSP 1 Score: 73.6 bits (179), Expect = 2.130e-16 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 0 Query: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35 MALKRINKELQDLG+DPPA CSAGPV DDL+HWQA Sbjct: 1 MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQA 35 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig8368.19544.1 ID=prot_M-pyrifera_M_contig8368.19544.1|Name=mRNA_M-pyrifera_M_contig8368.19544.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=35bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|