mRNA_M-pyrifera_M_contig82849.19354.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig82849.19354.1 vs. uniprot
Match: A0A7Y2DCK2_9ACTN (DUF5317 family protein n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A7Y2DCK2_9ACTN) HSP 1 Score: 63.2 bits (152), Expect = 8.530e-10 Identity = 31/90 (34.44%), Postives = 54/90 (60.00%), Query Frame = 1 Query: 31 MVLTPLAIAIGLVIGFLRGGRFDAVLENRVAAWPLLAAGIVFQTVGESFDVPGRAVVVMVGLLCLIGCAMKNLHIAGAAVAGIGVTLNMA 300 M+LT +A+A+GL++G L GG FD + + L+A G++ + E FD P +++ LL ++ A N+H+ G V +G+T+N+A Sbjct: 1 MLLTVIAVAVGLLLGRLSGGGFDRLGSTPIRFPLLMAIGLIVPALAERFDWPATNFIIVAALLAVVAFAGANMHMVGMGVVLVGITMNLA 90
BLAST of mRNA_M-pyrifera_M_contig82849.19354.1 vs. uniprot
Match: A0A7V9V6S3_9ACTN (DUF5317 domain-containing protein n=1 Tax=Actinomycetia bacterium TaxID=1883427 RepID=A0A7V9V6S3_9ACTN) HSP 1 Score: 52.4 bits (124), Expect = 5.550e-6 Identity = 28/89 (31.46%), Postives = 47/89 (52.81%), Query Frame = 1 Query: 40 TPLAIAIGLVIGFLRGGRFDAVLENRVAAWPLLAAGIVFQTVGESFDVPGRAVVVMVGLLCLIGCAMKNLHIAGAAVAGIGVTLNMAVL 306 T +A+A G++IG L GGR + + PLL G+ Q +G + V+++ L L+G A+ N + G + +GV LN+ V+ Sbjct: 4 TLMAVAAGILIGVLTGGRVRHLGDRTFRLLPLLVTGVALQALGVRMESTAGLVMILASYLLLLGFAVANASLVGMWLVALGVALNLLVI 92 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig82849.19354.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig82849.19354.1 >prot_M-pyrifera_M_contig82849.19354.1 ID=prot_M-pyrifera_M_contig82849.19354.1|Name=mRNA_M-pyrifera_M_contig82849.19354.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=102bp MLGSGLEIVDMVLTPLAIAIGLVIGFLRGGRFDAVLENRVAAWPLLAAGIback to top mRNA from alignment at M-pyrifera_M_contig82849:3..308- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig82849.19354.1 ID=mRNA_M-pyrifera_M_contig82849.19354.1|Name=mRNA_M-pyrifera_M_contig82849.19354.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=306bp|location=Sequence derived from alignment at M-pyrifera_M_contig82849:3..308- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig82849:3..308- >mRNA_M-pyrifera_M_contig82849.19354.1 ID=mRNA_M-pyrifera_M_contig82849.19354.1|Name=mRNA_M-pyrifera_M_contig82849.19354.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=612bp|location=Sequence derived from alignment at M-pyrifera_M_contig82849:3..308- (Macrocystis pyrifera P11B4 male)back to top |