mRNA_M-pyrifera_M_contig8193.19170.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8193.19170.1 vs. uniprot
Match: A0A6H5KMH3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KMH3_9PHAE) HSP 1 Score: 92.4 bits (228), Expect = 2.060e-22 Identity = 50/72 (69.44%), Postives = 58/72 (80.56%), Query Frame = 3 Query: 3 VIERLDIESVMATLDGDTITSDTVKDLFAGLSEKAKNSTTRVARLPSGQLSLEELKSLKERLDAKLQHLRST 218 VIERLDIE+ MA LD +TITSD VKDLFAGL EKAK S+TRVA LPS QL+ EL + K+RL +L+HLRST Sbjct: 6 VIERLDIEAAMAALDDETITSDKVKDLFAGLGEKAKASSTRVAALPSSQLNCAELAACKQRLKDRLEHLRST 77 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8193.19170.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8193.19170.1 >prot_M-pyrifera_M_contig8193.19170.1 ID=prot_M-pyrifera_M_contig8193.19170.1|Name=mRNA_M-pyrifera_M_contig8193.19170.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=78bp MATLDGDTITSDTVKDLFAGLSEKAKNSTTRVARLPSGQLSLEELKSLKEback to top mRNA from alignment at M-pyrifera_M_contig8193:6283..6617+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8193.19170.1 ID=mRNA_M-pyrifera_M_contig8193.19170.1|Name=mRNA_M-pyrifera_M_contig8193.19170.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=335bp|location=Sequence derived from alignment at M-pyrifera_M_contig8193:6283..6617+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8193:6283..6617+ >mRNA_M-pyrifera_M_contig8193.19170.1 ID=mRNA_M-pyrifera_M_contig8193.19170.1|Name=mRNA_M-pyrifera_M_contig8193.19170.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=468bp|location=Sequence derived from alignment at M-pyrifera_M_contig8193:6283..6617+ (Macrocystis pyrifera P11B4 male)back to top |