mRNA_M-pyrifera_M_contig8147.19057.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8147.19057.1 vs. uniprot
Match: D7G1H5_ECTSI (Regucalcin n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G1H5_ECTSI) HSP 1 Score: 60.5 bits (145), Expect = 9.540e-8 Identity = 23/36 (63.89%), Postives = 33/36 (91.67%), Query Frame = -1 Query: 397 SIGLDDRQRLDQPNAGALFAIRLQGIKGVPESCYHG 504 S+GL+D+QR++QPNAGA+FAIRL+G+KG+PE + G Sbjct: 277 SVGLNDQQRMEQPNAGAVFAIRLEGVKGIPEPRFRG 312 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8147.19057.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8147.19057.1 >prot_M-pyrifera_M_contig8147.19057.1 ID=prot_M-pyrifera_M_contig8147.19057.1|Name=mRNA_M-pyrifera_M_contig8147.19057.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=113bp STSGCPPGEAGSRSSRRRVPLSPKVGPGCLYVCPRSIRAVSNSTSGAVWDback to top mRNA from alignment at M-pyrifera_M_contig8147:591..1094+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8147.19057.1 ID=mRNA_M-pyrifera_M_contig8147.19057.1|Name=mRNA_M-pyrifera_M_contig8147.19057.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=504bp|location=Sequence derived from alignment at M-pyrifera_M_contig8147:591..1094+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8147:591..1094+ >mRNA_M-pyrifera_M_contig8147.19057.1 ID=mRNA_M-pyrifera_M_contig8147.19057.1|Name=mRNA_M-pyrifera_M_contig8147.19057.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=678bp|location=Sequence derived from alignment at M-pyrifera_M_contig8147:591..1094+ (Macrocystis pyrifera P11B4 male)back to top |