mRNA_M-pyrifera_M_contig81317.19021.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81317.19021.1 vs. uniprot
Match: A0A3M1DBJ2_9BACT (Uncharacterized protein (Fragment) n=1 Tax=Candidatus Parcubacteria bacterium TaxID=2762014 RepID=A0A3M1DBJ2_9BACT) HSP 1 Score: 51.6 bits (122), Expect = 3.660e-5 Identity = 25/63 (39.68%), Postives = 37/63 (58.73%), Query Frame = 1 Query: 64 ERTISVAVPAGTYSVTAASYDGYDNRETT--GVQEYEQYVLQFLDAGGNVLDTTTPTADLPEG 246 + T V +PAG Y+++ SYDGY+ RE T Q EQ+ + +D+ G + T PT DL +G Sbjct: 92 QETQPVTLPAGRYTISYYSYDGYEGREKTDPNTQNKEQWNMLLIDSSGKTITTFGPTPDLKDG 154 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81317.19021.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig81317.19021.1 >prot_M-pyrifera_M_contig81317.19021.1 ID=prot_M-pyrifera_M_contig81317.19021.1|Name=mRNA_M-pyrifera_M_contig81317.19021.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=120bp PNTGYGNAWQASVYANPDRVNERTISVAVPAGTYSVTAASYDGYDNRETTback to top mRNA from alignment at M-pyrifera_M_contig81317:3..362- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig81317.19021.1 ID=mRNA_M-pyrifera_M_contig81317.19021.1|Name=mRNA_M-pyrifera_M_contig81317.19021.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=360bp|location=Sequence derived from alignment at M-pyrifera_M_contig81317:3..362- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig81317:3..362- >mRNA_M-pyrifera_M_contig81317.19021.1 ID=mRNA_M-pyrifera_M_contig81317.19021.1|Name=mRNA_M-pyrifera_M_contig81317.19021.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=720bp|location=Sequence derived from alignment at M-pyrifera_M_contig81317:3..362- (Macrocystis pyrifera P11B4 male)back to top |