mRNA_M-pyrifera_M_contig80128.18779.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig80128.18779.1 vs. uniprot
Match: D8LAZ3_ECTSI (L-type lectin-like domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LAZ3_ECTSI) HSP 1 Score: 103 bits (256), Expect = 1.740e-24 Identity = 48/58 (82.76%), Postives = 54/58 (93.10%), Query Frame = 1 Query: 1 RFVSFIANNGTRTTEDVRMLANSCASTLRYYERRDDFNFLKSSRVRLGYHDGAVTLEV 174 +FVSFIANNGTRTTEDVRM ANSCASTLRYY+ RDDFNFLK SR+RLGY+DG ++LEV Sbjct: 191 QFVSFIANNGTRTTEDVRMAANSCASTLRYYQGRDDFNFLKMSRIRLGYYDGEISLEV 248
BLAST of mRNA_M-pyrifera_M_contig80128.18779.1 vs. uniprot
Match: A0A835ZHK2_9STRA (L-type lectin-like domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZHK2_9STRA) HSP 1 Score: 48.1 bits (113), Expect = 1.790e-5 Identity = 26/59 (44.07%), Postives = 34/59 (57.63%), Query Frame = 1 Query: 1 RFVSFIANNGTRTTEDVRMLANSCASTLRYYERRDDFNFLKSSRVRLGYH-DGAVTLEV 174 R +S + NNG + V C + LRY+E RDDF LKSSR+RL + D + LEV Sbjct: 25 RDISMVTNNGRKGGAQVMTELQGCNANLRYWEGRDDFTVLKSSRLRLRFSSDNTLILEV 83 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig80128.18779.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig80128.18779.1 >prot_M-pyrifera_M_contig80128.18779.1 ID=prot_M-pyrifera_M_contig80128.18779.1|Name=mRNA_M-pyrifera_M_contig80128.18779.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=58bp RFVSFIANNGTRTTEDVRMLANSCASTLRYYERRDDFNFLKSSRVRLGYHback to top mRNA from alignment at M-pyrifera_M_contig80128:113..286- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig80128.18779.1 ID=mRNA_M-pyrifera_M_contig80128.18779.1|Name=mRNA_M-pyrifera_M_contig80128.18779.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=174bp|location=Sequence derived from alignment at M-pyrifera_M_contig80128:113..286- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig80128:113..286- >mRNA_M-pyrifera_M_contig80128.18779.1 ID=mRNA_M-pyrifera_M_contig80128.18779.1|Name=mRNA_M-pyrifera_M_contig80128.18779.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=348bp|location=Sequence derived from alignment at M-pyrifera_M_contig80128:113..286- (Macrocystis pyrifera P11B4 male)back to top |