prot_M-pyrifera_M_contig80128.18779.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig80128.18779.1 vs. uniprot
Match: D8LAZ3_ECTSI (L-type lectin-like domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LAZ3_ECTSI) HSP 1 Score: 103 bits (256), Expect = 1.740e-24 Identity = 48/58 (82.76%), Postives = 54/58 (93.10%), Query Frame = 0 Query: 1 RFVSFIANNGTRTTEDVRMLANSCASTLRYYERRDDFNFLKSSRVRLGYHDGAVTLEV 58 +FVSFIANNGTRTTEDVRM ANSCASTLRYY+ RDDFNFLK SR+RLGY+DG ++LEV Sbjct: 191 QFVSFIANNGTRTTEDVRMAANSCASTLRYYQGRDDFNFLKMSRIRLGYYDGEISLEV 248
BLAST of mRNA_M-pyrifera_M_contig80128.18779.1 vs. uniprot
Match: A0A835ZHK2_9STRA (L-type lectin-like domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZHK2_9STRA) HSP 1 Score: 48.1 bits (113), Expect = 1.790e-5 Identity = 26/59 (44.07%), Postives = 34/59 (57.63%), Query Frame = 0 Query: 1 RFVSFIANNGTRTTEDVRMLANSCASTLRYYERRDDFNFLKSSRVRLGYH-DGAVTLEV 58 R +S + NNG + V C + LRY+E RDDF LKSSR+RL + D + LEV Sbjct: 25 RDISMVTNNGRKGGAQVMTELQGCNANLRYWEGRDDFTVLKSSRLRLRFSSDNTLILEV 83 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig80128.18779.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig80128.18779.1 ID=prot_M-pyrifera_M_contig80128.18779.1|Name=mRNA_M-pyrifera_M_contig80128.18779.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=58bpback to top |