mRNA_M-pyrifera_M_contig78399.18426.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig78399.18426.1 vs. uniprot
Match: UPI001260ED78 (type II toxin-antitoxin system ParD family antitoxin n=1 Tax=Tautonia marina TaxID=2653855 RepID=UPI001260ED78) HSP 1 Score: 48.1 bits (113), Expect = 2.320e-5 Identity = 28/76 (36.84%), Postives = 42/76 (55.26%), Query Frame = 1 Query: 28 LEDRLEGGPYASLAELIEEALKALDQSVATE----DWLEEKLREAEASGPAAPMTQQDWDDIEREGFERIRAKSPK 243 + +L+ G YAS +++++AL L Q A + +E L + SGPA PMT DWD++EREG I + K Sbjct: 13 IRSQLQSGKYASEDDVVDQALDLLRQREAEQASERSRVESLLIQGLDSGPATPMTSDDWDEVEREGQRLIAERKAK 88
BLAST of mRNA_M-pyrifera_M_contig78399.18426.1 vs. uniprot
Match: UPI001993B626 (Type II toxin-antitoxin system ParD family antitoxin n=1 Tax=Gloeobacterales cyanobacterium ES-bin-313 TaxID=2812629 RepID=UPI001993B626) HSP 1 Score: 46.6 bits (109), Expect = 9.640e-5 Identity = 29/79 (36.71%), Postives = 43/79 (54.43%), Query Frame = 1 Query: 4 LPQKLLHELEDRLEGGPYASLAELIEEALKALDQSVATEDWLEEKLREAEASGPAAPMTQQDWDDIEREGFERIRAKSP 240 LP+ + +E R++ G +++ +E + AL DQ E+ LE L E SGPA PMT QDW +I E R++ P Sbjct: 8 LPKVMKDYVESRVQEGGFSTPSEYMR-ALVREDQKRKAEEKLEALLLEGIQSGPATPMTPQDWKEIRAEVLRRVQRGEP 85 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig78399.18426.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig78399.18426.1 >prot_M-pyrifera_M_contig78399.18426.1 ID=prot_M-pyrifera_M_contig78399.18426.1|Name=mRNA_M-pyrifera_M_contig78399.18426.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=82bp MLPQKLLHELEDRLEGGPYASLAELIEEALKALDQSVATEDWLEEKLREAback to top mRNA from alignment at M-pyrifera_M_contig78399:691..936- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig78399.18426.1 ID=mRNA_M-pyrifera_M_contig78399.18426.1|Name=mRNA_M-pyrifera_M_contig78399.18426.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=246bp|location=Sequence derived from alignment at M-pyrifera_M_contig78399:691..936- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig78399:691..936- >mRNA_M-pyrifera_M_contig78399.18426.1 ID=mRNA_M-pyrifera_M_contig78399.18426.1|Name=mRNA_M-pyrifera_M_contig78399.18426.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=492bp|location=Sequence derived from alignment at M-pyrifera_M_contig78399:691..936- (Macrocystis pyrifera P11B4 male)back to top |