mRNA_M-pyrifera_M_contig77464.18236.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77464.18236.1 vs. uniprot
Match: A0A1H6FF12_9GAMM (Serine/threonine-protein kinase D n=1 Tax=Thiotrichales bacterium HS_08 TaxID=1899563 RepID=A0A1H6FF12_9GAMM) HSP 1 Score: 55.5 bits (132), Expect = 1.220e-6 Identity = 30/76 (39.47%), Postives = 43/76 (56.58%), Query Frame = 1 Query: 7 RLGHSRVALCLLKNIAANGDVNTQFMMADIYSRSLPELFPRSDITPSMAREWAHSAASSGHAKAQNLLGALYEQGD 234 R G+ +VAL L+ +AA+G + QF +A++Y + P L + A W H AA HAKAQN L +YE G+ Sbjct: 381 RSGNHQVALDKLRQLAADGYIEAQFTLANLYDQGAPGLAEDNR----QAVHWYHEAAEQDHAKAQNNLAVMYEHGE 452 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77464.18236.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig77464.18236.1 >prot_M-pyrifera_M_contig77464.18236.1 ID=prot_M-pyrifera_M_contig77464.18236.1|Name=mRNA_M-pyrifera_M_contig77464.18236.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=108bp LLRLGHSRVALCLLKNIAANGDVNTQFMMADIYSRSLPELFPRSDITPSMback to top mRNA from alignment at M-pyrifera_M_contig77464:308..631+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig77464.18236.1 ID=mRNA_M-pyrifera_M_contig77464.18236.1|Name=mRNA_M-pyrifera_M_contig77464.18236.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=324bp|location=Sequence derived from alignment at M-pyrifera_M_contig77464:308..631+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig77464:308..631+ >mRNA_M-pyrifera_M_contig77464.18236.1 ID=mRNA_M-pyrifera_M_contig77464.18236.1|Name=mRNA_M-pyrifera_M_contig77464.18236.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=648bp|location=Sequence derived from alignment at M-pyrifera_M_contig77464:308..631+ (Macrocystis pyrifera P11B4 male)back to top |