prot_M-pyrifera_M_contig77464.18236.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77464.18236.1 vs. uniprot
Match: A0A1H6FF12_9GAMM (Serine/threonine-protein kinase D n=1 Tax=Thiotrichales bacterium HS_08 TaxID=1899563 RepID=A0A1H6FF12_9GAMM) HSP 1 Score: 55.5 bits (132), Expect = 1.220e-6 Identity = 30/76 (39.47%), Postives = 43/76 (56.58%), Query Frame = 0 Query: 3 RLGHSRVALCLLKNIAANGDVNTQFMMADIYSRSLPELFPRSDITPSMAREWAHSAASSGHAKAQNLLGALYEQGD 78 R G+ +VAL L+ +AA+G + QF +A++Y + P L + A W H AA HAKAQN L +YE G+ Sbjct: 381 RSGNHQVALDKLRQLAADGYIEAQFTLANLYDQGAPGLAEDNR----QAVHWYHEAAEQDHAKAQNNLAVMYEHGE 452 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77464.18236.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig77464.18236.1 ID=prot_M-pyrifera_M_contig77464.18236.1|Name=mRNA_M-pyrifera_M_contig77464.18236.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=108bpback to top |