mRNA_M-pyrifera_M_contig76738.18086.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig76738.18086.1 vs. uniprot
Match: A0A2E7RKS9_9BACT (Uncharacterized protein (Fragment) n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2E7RKS9_9BACT) HSP 1 Score: 51.6 bits (122), Expect = 5.230e-5 Identity = 24/41 (58.54%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 1 PTGSQIVSASWDNTLRIWDADLGTELTLLGGRFGHKKRVAS 123 P+G++IVS SWDNTLRIWDA+ G EL L G H++ V+S Sbjct: 6 PSGTRIVSGSWDNTLRIWDAETGAELQTLRG---HEESVSS 43 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig76738.18086.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig76738.18086.1 >prot_M-pyrifera_M_contig76738.18086.1 ID=prot_M-pyrifera_M_contig76738.18086.1|Name=mRNA_M-pyrifera_M_contig76738.18086.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=148bp PTGSQIVSASWDNTLRIWDADLGTELTLLGGRFGHKKRVASCAYSTDGSLback to top mRNA from alignment at M-pyrifera_M_contig76738:2..445+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig76738.18086.1 ID=mRNA_M-pyrifera_M_contig76738.18086.1|Name=mRNA_M-pyrifera_M_contig76738.18086.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=444bp|location=Sequence derived from alignment at M-pyrifera_M_contig76738:2..445+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig76738:2..445+ >mRNA_M-pyrifera_M_contig76738.18086.1 ID=mRNA_M-pyrifera_M_contig76738.18086.1|Name=mRNA_M-pyrifera_M_contig76738.18086.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=888bp|location=Sequence derived from alignment at M-pyrifera_M_contig76738:2..445+ (Macrocystis pyrifera P11B4 male)back to top |