mRNA_M-pyrifera_M_contig75934.17916.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75934.17916.1 vs. uniprot
Match: D7FH00_ECTSI (G_PROTEIN_RECEP_F3_4 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH00_ECTSI) HSP 1 Score: 59.7 bits (143), Expect = 4.450e-9 Identity = 30/52 (57.69%), Postives = 36/52 (69.23%), Query Frame = 1 Query: 1 IGLSVTFFSALALVGPNRAFTCALRLWLWSFGFDLAFGALVLKLWHALNAVE 156 +G+ VTF S AL+G TCALRLW +S GFDLAFGAL LK+ A +A E Sbjct: 176 VGIGVTFLSIFALLGATTDLTCALRLWGYSAGFDLAFGALTLKMRSACSAAE 227 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75934.17916.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig75934.17916.1 >prot_M-pyrifera_M_contig75934.17916.1 ID=prot_M-pyrifera_M_contig75934.17916.1|Name=mRNA_M-pyrifera_M_contig75934.17916.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=52bp IGLSVTFFSALALVGPNRAFTCALRLWLWSFGFDLAFGALVLKLWHALNAback to top mRNA from alignment at M-pyrifera_M_contig75934:665..820- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig75934.17916.1 ID=mRNA_M-pyrifera_M_contig75934.17916.1|Name=mRNA_M-pyrifera_M_contig75934.17916.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=156bp|location=Sequence derived from alignment at M-pyrifera_M_contig75934:665..820- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig75934:665..820- >mRNA_M-pyrifera_M_contig75934.17916.1 ID=mRNA_M-pyrifera_M_contig75934.17916.1|Name=mRNA_M-pyrifera_M_contig75934.17916.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=312bp|location=Sequence derived from alignment at M-pyrifera_M_contig75934:665..820- (Macrocystis pyrifera P11B4 male)back to top |