mRNA_M-pyrifera_M_contig75821.17886.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75821.17886.1 vs. uniprot
Match: A0A534Q683_9DELT (Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A534Q683_9DELT) HSP 1 Score: 48.9 bits (115), Expect = 1.020e-5 Identity = 27/71 (38.03%), Postives = 36/71 (50.70%), Query Frame = 1 Query: 1 PQASGTVRGTLEVGGWILRPEDGTAPLQDAKSTLATYVVISDPGGGIPTFLVERVLAGQMRLGEALAKAIK 213 P G +R + G W + P DG K TLATY +++DPGG IPTF+ + A L E A+ K Sbjct: 28 PPEDGVIRLKVNTGSWTMEPIDG------GKRTLATYQLLTDPGGSIPTFIANK--ANTKALPELFARVRK 90 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75821.17886.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig75821.17886.1 >prot_M-pyrifera_M_contig75821.17886.1 ID=prot_M-pyrifera_M_contig75821.17886.1|Name=mRNA_M-pyrifera_M_contig75821.17886.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=76bp PQASGTVRGTLEVGGWILRPEDGTAPLQDAKSTLATYVVISDPGGGIPTFback to top mRNA from alignment at M-pyrifera_M_contig75821:599..865+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig75821.17886.1 ID=mRNA_M-pyrifera_M_contig75821.17886.1|Name=mRNA_M-pyrifera_M_contig75821.17886.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=267bp|location=Sequence derived from alignment at M-pyrifera_M_contig75821:599..865+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig75821:599..865+ >mRNA_M-pyrifera_M_contig75821.17886.1 ID=mRNA_M-pyrifera_M_contig75821.17886.1|Name=mRNA_M-pyrifera_M_contig75821.17886.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=456bp|location=Sequence derived from alignment at M-pyrifera_M_contig75821:599..865+ (Macrocystis pyrifera P11B4 male)back to top |