mRNA_M-pyrifera_M_contig75653.17845.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75653.17845.1 vs. uniprot
Match: A0A7I8W1M3_9ANNE (Hypothetical protein n=1 Tax=Dimorphilus gyrociliatus TaxID=2664684 RepID=A0A7I8W1M3_9ANNE) HSP 1 Score: 49.7 bits (117), Expect = 2.150e-5 Identity = 26/52 (50.00%), Postives = 32/52 (61.54%), Query Frame = 1 Query: 22 KRGWGVDEGVFYVGDGRGDLCPAMVLRKGDMVCAREKFPLAEELKRSPPPLE 177 K G D+ V YVGDG DLCPA+ LRK D+VC R F L + ++ PP E Sbjct: 166 KTNGGYDK-VMYVGDGYNDLCPALRLRKSDVVCPRIGFSLKKSIENLAPPHE 216
BLAST of mRNA_M-pyrifera_M_contig75653.17845.1 vs. uniprot
Match: A0A7C9EWX3_OPUST (Uncharacterized protein (Fragment) n=1 Tax=Opuntia streptacantha TaxID=393608 RepID=A0A7C9EWX3_OPUST) HSP 1 Score: 47.0 bits (110), Expect = 7.750e-5 Identity = 20/42 (47.62%), Postives = 26/42 (61.90%), Query Frame = 1 Query: 40 DEGVFYVGDGRGDLCPAMVLRKGDMVCAREKFPLAEELKRSP 165 D+ Y+GDG GD CP+M LRKGD R+ FPL + +P Sbjct: 36 DQTFIYLGDGNGDYCPSMKLRKGDYCMPRKNFPLWHVISSNP 77 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75653.17845.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig75653.17845.1 >prot_M-pyrifera_M_contig75653.17845.1 ID=prot_M-pyrifera_M_contig75653.17845.1|Name=mRNA_M-pyrifera_M_contig75653.17845.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=65bp DDLVDGRKRGWGVDEGVFYVGDGRGDLCPAMVLRKGDMVCAREKFPLAEEback to top mRNA from alignment at M-pyrifera_M_contig75653:757..951- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig75653.17845.1 ID=mRNA_M-pyrifera_M_contig75653.17845.1|Name=mRNA_M-pyrifera_M_contig75653.17845.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=195bp|location=Sequence derived from alignment at M-pyrifera_M_contig75653:757..951- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig75653:757..951- >mRNA_M-pyrifera_M_contig75653.17845.1 ID=mRNA_M-pyrifera_M_contig75653.17845.1|Name=mRNA_M-pyrifera_M_contig75653.17845.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=390bp|location=Sequence derived from alignment at M-pyrifera_M_contig75653:757..951- (Macrocystis pyrifera P11B4 male)back to top |