mRNA_M-pyrifera_M_contig75367.17788.1 (mRNA) Macrocystis pyrifera P11B4 male
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75367.17788.1 vs. uniprot
Match: A0D7P8_PARTE (Uncharacterized protein n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0D7P8_PARTE) HSP 1 Score: 60.8 bits (146), Expect = 3.500e-9 Identity = 30/68 (44.12%), Postives = 38/68 (55.88%), Query Frame = 1 Query: 1 VHEIAEMESQLRSEVGPQFGFDLADVYRHFAHRLAVRDALPALSAGVLVPLQARHRYGDHHHVLTYAR 204 + IA + R EVGPQFGFDL + +H+ H +R L G +V L A H YG H HVL +AR Sbjct: 936 ISNIATAQENFRREVGPQFGFDLQQIGKHYVHIRQMRKQHKVLRNGQMVSLSAEHMYGWHTHVLAFAR 1003
BLAST of mRNA_M-pyrifera_M_contig75367.17788.1 vs. uniprot
Match: A0BEG4_PARTE (Uncharacterized protein n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0BEG4_PARTE) HSP 1 Score: 57.0 bits (136), Expect = 7.730e-8 Identity = 28/68 (41.18%), Postives = 36/68 (52.94%), Query Frame = 1 Query: 1 VHEIAEMESQLRSEVGPQFGFDLADVYRHFAHRLAVRDALPALSAGVLVPLQARHRYGDHHHVLTYAR 204 + IA R EVGPQFGFDL + +H+ + +R L G +V L A H YG H HVL + R Sbjct: 381 ISNIATARENFRREVGPQFGFDLQQIGKHYVYIRQIRKQHKVLRNGQIVSLSAEHMYGWHTHVLAFGR 448 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75367.17788.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig75367.17788.1 >prot_M-pyrifera_M_contig75367.17788.1 ID=prot_M-pyrifera_M_contig75367.17788.1|Name=mRNA_M-pyrifera_M_contig75367.17788.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=62bp MESQLRSEVGPQFGFDLADVYRHFAHRLAVRDALPALSAGVLVPLQARHRback to top mRNA from alignment at M-pyrifera_M_contig75367:274..477- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig75367.17788.1 ID=mRNA_M-pyrifera_M_contig75367.17788.1|Name=mRNA_M-pyrifera_M_contig75367.17788.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=204bp|location=Sequence derived from alignment at M-pyrifera_M_contig75367:274..477- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig75367:274..477- >mRNA_M-pyrifera_M_contig75367.17788.1 ID=mRNA_M-pyrifera_M_contig75367.17788.1|Name=mRNA_M-pyrifera_M_contig75367.17788.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=372bp|location=Sequence derived from alignment at M-pyrifera_M_contig75367:274..477- (Macrocystis pyrifera P11B4 male)back to top |