mRNA_M-pyrifera_M_contig74231.17582.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74231.17582.1 vs. uniprot
Match: D7FJY9_ECTSI (Palmitoyltransferase n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FJY9_ECTSI) HSP 1 Score: 62.0 bits (149), Expect = 4.350e-10 Identity = 28/39 (71.79%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 10 VLLAFIFCAVSYLLGWHGYLVAGNVTTIEYFKVRRCERN 126 ++L F+FC+VSYLL WHGYLVAGNVTTIEYFK +R R+ Sbjct: 216 LVLGFVFCSVSYLLIWHGYLVAGNVTTIEYFKWKRSMRD 254 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74231.17582.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig74231.17582.1 >prot_M-pyrifera_M_contig74231.17582.1 ID=prot_M-pyrifera_M_contig74231.17582.1|Name=mRNA_M-pyrifera_M_contig74231.17582.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=42bp MRRVLLAFIFCAVSYLLGWHGYLVAGNVTTIEYFKVRRCERNback to top mRNA from alignment at M-pyrifera_M_contig74231:268..393+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig74231.17582.1 ID=mRNA_M-pyrifera_M_contig74231.17582.1|Name=mRNA_M-pyrifera_M_contig74231.17582.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=126bp|location=Sequence derived from alignment at M-pyrifera_M_contig74231:268..393+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig74231:268..393+ >mRNA_M-pyrifera_M_contig74231.17582.1 ID=mRNA_M-pyrifera_M_contig74231.17582.1|Name=mRNA_M-pyrifera_M_contig74231.17582.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=252bp|location=Sequence derived from alignment at M-pyrifera_M_contig74231:268..393+ (Macrocystis pyrifera P11B4 male)back to top |