mRNA_M-pyrifera_M_contig74168.17563.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74168.17563.1 vs. uniprot
Match: D7FYL8_ECTSI (Anaphase-promoting complex subunit 4 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FYL8_ECTSI) HSP 1 Score: 86.3 bits (212), Expect = 1.440e-18 Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 1 MAAAGRNFSIIHEKIMPCRLVCMCPTMDLVASIHADGQLSVHR 129 MAAAGRNFSIIHEK++ CRLVCMCPTMDLVAS+H DGQLSVHR Sbjct: 1 MAAAGRNFSIIHEKLLHCRLVCMCPTMDLVASLHVDGQLSVHR 43
BLAST of mRNA_M-pyrifera_M_contig74168.17563.1 vs. uniprot
Match: A0A150G3A6_GONPE (Anaphase-promoting complex subunit 4 n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150G3A6_GONPE) HSP 1 Score: 51.6 bits (122), Expect = 2.340e-6 Identity = 24/45 (53.33%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 7 AAGRNFSIIHEKIMPCRLV--CMCPTMDLVASIHADGQLSVHRFE 135 A FS++HEK + ++V C CPTMDL+A + DGQLSVHR E Sbjct: 16 AGAMAFSVLHEKALSQQVVLGCWCPTMDLLALVSDDGQLSVHRLE 60 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74168.17563.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig74168.17563.1 >prot_M-pyrifera_M_contig74168.17563.1 ID=prot_M-pyrifera_M_contig74168.17563.1|Name=mRNA_M-pyrifera_M_contig74168.17563.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=45bp MAAAGRNFSIIHEKIMPCRLVCMCPTMDLVASIHADGQLSVHRFEback to top mRNA from alignment at M-pyrifera_M_contig74168:116..250- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig74168.17563.1 ID=mRNA_M-pyrifera_M_contig74168.17563.1|Name=mRNA_M-pyrifera_M_contig74168.17563.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=135bp|location=Sequence derived from alignment at M-pyrifera_M_contig74168:116..250- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig74168:116..250- >mRNA_M-pyrifera_M_contig74168.17563.1 ID=mRNA_M-pyrifera_M_contig74168.17563.1|Name=mRNA_M-pyrifera_M_contig74168.17563.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=270bp|location=Sequence derived from alignment at M-pyrifera_M_contig74168:116..250- (Macrocystis pyrifera P11B4 male)back to top |