prot_M-pyrifera_M_contig74168.17563.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74168.17563.1 vs. uniprot
Match: D7FYL8_ECTSI (Anaphase-promoting complex subunit 4 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FYL8_ECTSI) HSP 1 Score: 86.3 bits (212), Expect = 1.440e-18 Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 0 Query: 1 MAAAGRNFSIIHEKIMPCRLVCMCPTMDLVASIHADGQLSVHR 43 MAAAGRNFSIIHEK++ CRLVCMCPTMDLVAS+H DGQLSVHR Sbjct: 1 MAAAGRNFSIIHEKLLHCRLVCMCPTMDLVASLHVDGQLSVHR 43
BLAST of mRNA_M-pyrifera_M_contig74168.17563.1 vs. uniprot
Match: A0A150G3A6_GONPE (Anaphase-promoting complex subunit 4 n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150G3A6_GONPE) HSP 1 Score: 51.6 bits (122), Expect = 2.340e-6 Identity = 24/45 (53.33%), Postives = 31/45 (68.89%), Query Frame = 0 Query: 3 AAGRNFSIIHEKIMPCRLV--CMCPTMDLVASIHADGQLSVHRFE 45 A FS++HEK + ++V C CPTMDL+A + DGQLSVHR E Sbjct: 16 AGAMAFSVLHEKALSQQVVLGCWCPTMDLLALVSDDGQLSVHRLE 60 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74168.17563.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig74168.17563.1 ID=prot_M-pyrifera_M_contig74168.17563.1|Name=mRNA_M-pyrifera_M_contig74168.17563.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=45bpback to top |