mRNA_M-pyrifera_M_contig7390.17509.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7390.17509.1 vs. uniprot
Match: A0A2R5GUZ2_9STRA (Uncharacterized protein n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GUZ2_9STRA) HSP 1 Score: 62.8 bits (151), Expect = 1.050e-9 Identity = 31/80 (38.75%), Postives = 50/80 (62.50%), Query Frame = 1 Query: 1 GQPAVVICFSCIRFDEG-RGHYCRSCFDTYHPWYRVAHKWAPVEDAEGATEQIDQQVY--RTAIERTVSDLRGLLQITSS 231 G PAV+ CFSCI+FD +GH+C+SCF HP +R+ H + + D + A + + +++ R IER V + +L+I S+ Sbjct: 277 GTPAVIKCFSCIKFDPLLQGHFCKSCFLHSHPPHRLEHNFIRINDIDSAPLKQEWRIHMQRLEIERRVLQYKDVLEIISA 356 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7390.17509.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig7390.17509.1 >prot_M-pyrifera_M_contig7390.17509.1 ID=prot_M-pyrifera_M_contig7390.17509.1|Name=mRNA_M-pyrifera_M_contig7390.17509.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=77bp GQPAVVICFSCIRFDEGRGHYCRSCFDTYHPWYRVAHKWAPVEDAEGATEback to top mRNA from alignment at M-pyrifera_M_contig7390:12598..12828+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig7390.17509.1 ID=mRNA_M-pyrifera_M_contig7390.17509.1|Name=mRNA_M-pyrifera_M_contig7390.17509.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=231bp|location=Sequence derived from alignment at M-pyrifera_M_contig7390:12598..12828+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig7390:12598..12828+ >mRNA_M-pyrifera_M_contig7390.17509.1 ID=mRNA_M-pyrifera_M_contig7390.17509.1|Name=mRNA_M-pyrifera_M_contig7390.17509.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=462bp|location=Sequence derived from alignment at M-pyrifera_M_contig7390:12598..12828+ (Macrocystis pyrifera P11B4 male)back to top |