mRNA_M-pyrifera_M_contig72699.17266.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72699.17266.1 vs. uniprot
Match: D7G3N4_ECTSI (Rhomboid domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G3N4_ECTSI) HSP 1 Score: 125 bits (313), Expect = 1.070e-31 Identity = 58/75 (77.33%), Postives = 63/75 (84.00%), Query Frame = 1 Query: 1 HLAGIFMGYLMSWGMLGRLSTPILCGASVILMLQHSKGWARNMPDFSLLLQGWAGGDSGRVARARRLSTSFVAHV 225 HL+GIFMGYLM+WG LG LS PIL G SVI MLQHSK WAR MPDFSLLLQ WAGGD+GRVARARR+ +F AHV Sbjct: 378 HLSGIFMGYLMAWGFLGGLSIPILAGISVIFMLQHSKAWARRMPDFSLLLQSWAGGDAGRVARARRMGYAFAAHV 452 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72699.17266.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig72699.17266.1 >prot_M-pyrifera_M_contig72699.17266.1 ID=prot_M-pyrifera_M_contig72699.17266.1|Name=mRNA_M-pyrifera_M_contig72699.17266.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=70bp MGYLMSWGMLGRLSTPILCGASVILMLQHSKGWARNMPDFSLLLQGWAGGback to top mRNA from alignment at M-pyrifera_M_contig72699:509..736+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig72699.17266.1 ID=mRNA_M-pyrifera_M_contig72699.17266.1|Name=mRNA_M-pyrifera_M_contig72699.17266.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=228bp|location=Sequence derived from alignment at M-pyrifera_M_contig72699:509..736+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig72699:509..736+ >mRNA_M-pyrifera_M_contig72699.17266.1 ID=mRNA_M-pyrifera_M_contig72699.17266.1|Name=mRNA_M-pyrifera_M_contig72699.17266.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=420bp|location=Sequence derived from alignment at M-pyrifera_M_contig72699:509..736+ (Macrocystis pyrifera P11B4 male)back to top |