mRNA_M-pyrifera_M_contig72152.17169.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72152.17169.1 vs. uniprot
Match: D7FMS9_ECTSI (Rubredoxin-like domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMS9_ECTSI) HSP 1 Score: 84.0 bits (206), Expect = 7.740e-18 Identity = 35/48 (72.92%), Postives = 40/48 (83.33%), Query Frame = 1 Query: 1 GGDVSKTAMAEINWDHVVTEPEHLKELKAYRCEECGYTLFPARGEARV 144 GG + KT+M+E+ WDH+VTEPEHL ELKAY CEECGYTLFPARG V Sbjct: 218 GGSLKKTSMSELKWDHIVTEPEHLLELKAYCCEECGYTLFPARGRHEV 265
BLAST of mRNA_M-pyrifera_M_contig72152.17169.1 vs. uniprot
Match: A0A836CG96_9STRA (Rubredoxin-like domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CG96_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 3.610e-11 Identity = 25/43 (58.14%), Postives = 33/43 (76.74%), Query Frame = 1 Query: 1 GGDVSKTAMAEINWDHVVTEPEHLKELKAYRCEECGYTLFPAR 129 G + + E+ W+++VTE EH+KEL AYRCE+CGYTLFPAR Sbjct: 25 GFSIRRVMAPELKWEYLVTEKEHIKELHAYRCEQCGYTLFPAR 67 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72152.17169.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig72152.17169.1 >prot_M-pyrifera_M_contig72152.17169.1 ID=prot_M-pyrifera_M_contig72152.17169.1|Name=mRNA_M-pyrifera_M_contig72152.17169.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=40bp MAEINWDHVVTEPEHLKELKAYRCEECGYTLFPARGEARVback to top mRNA from alignment at M-pyrifera_M_contig72152:673..816- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig72152.17169.1 ID=mRNA_M-pyrifera_M_contig72152.17169.1|Name=mRNA_M-pyrifera_M_contig72152.17169.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=144bp|location=Sequence derived from alignment at M-pyrifera_M_contig72152:673..816- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig72152:673..816- >mRNA_M-pyrifera_M_contig72152.17169.1 ID=mRNA_M-pyrifera_M_contig72152.17169.1|Name=mRNA_M-pyrifera_M_contig72152.17169.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=240bp|location=Sequence derived from alignment at M-pyrifera_M_contig72152:673..816- (Macrocystis pyrifera P11B4 male)back to top |