prot_M-pyrifera_M_contig72152.17169.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72152.17169.1 vs. uniprot
Match: D7FMS9_ECTSI (Rubredoxin-like domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMS9_ECTSI) HSP 1 Score: 74.7 bits (182), Expect = 1.180e-14 Identity = 31/40 (77.50%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 1 MAEINWDHVVTEPEHLKELKAYRCEECGYTLFPARGEARV 40 M+E+ WDH+VTEPEHL ELKAY CEECGYTLFPARG V Sbjct: 226 MSELKWDHIVTEPEHLLELKAYCCEECGYTLFPARGRHEV 265
BLAST of mRNA_M-pyrifera_M_contig72152.17169.1 vs. uniprot
Match: A0A836CG96_9STRA (Rubredoxin-like domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CG96_9STRA) HSP 1 Score: 62.8 bits (151), Expect = 9.690e-11 Identity = 24/33 (72.73%), Postives = 30/33 (90.91%), Query Frame = 0 Query: 3 EINWDHVVTEPEHLKELKAYRCEECGYTLFPAR 35 E+ W+++VTE EH+KEL AYRCE+CGYTLFPAR Sbjct: 35 ELKWEYLVTEKEHIKELHAYRCEQCGYTLFPAR 67 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72152.17169.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig72152.17169.1 ID=prot_M-pyrifera_M_contig72152.17169.1|Name=mRNA_M-pyrifera_M_contig72152.17169.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=40bpback to top |