mRNA_M-pyrifera_M_contig72087.17156.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72087.17156.1 vs. uniprot
Match: UPI0010A9E817 (autotransporter domain-containing protein n=1 Tax=Nitratireductor sp. XY-223 TaxID=2561926 RepID=UPI0010A9E817) HSP 1 Score: 59.7 bits (143), Expect = 8.430e-7 Identity = 31/63 (49.21%), Postives = 42/63 (66.67%), Query Frame = 1 Query: 31 AQAQDITIPSGTTVTTTQEITADGEGVTIEKGGSIDTVASSVRAVEGTANNQTFTNHGLIDSG 219 A A D+T+ +GTT TTTQ I DG+ +T+E+GG+IDT A+ + V T +NQT N G I G Sbjct: 27 AIAADVTVSTGTTETTTQTIDEDGDTLTVEEGGTIDTTAAGTQGVRATGDNQTVINRGTIKGG 89
BLAST of mRNA_M-pyrifera_M_contig72087.17156.1 vs. uniprot
Match: UPI00145A346A (autotransporter domain-containing protein n=1 Tax=Nitratireductor sp. XY-223 TaxID=2561926 RepID=UPI00145A346A) HSP 1 Score: 58.9 bits (141), Expect = 1.510e-6 Identity = 37/73 (50.68%), Postives = 45/73 (61.64%), Query Frame = 1 Query: 31 AQAQDITIPSGTTVTTTQEITADGEGVTIEKGGSIDTVASS-VRAVEGTANNQTFTNHGLIDSGDTGLRSNGD 246 A A D+TI S TT TTTQ I DG+ +T+E GG IDT A++ VE TA+NQT N G I G+ S GD Sbjct: 42 AGAADVTIDSNTTETTTQTIDEDGDTLTVEDGGIIDTSATADANGVEATADNQTMINDGTITGNKYGIHSYGD 114 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72087.17156.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig72087.17156.1 >prot_M-pyrifera_M_contig72087.17156.1 ID=prot_M-pyrifera_M_contig72087.17156.1|Name=mRNA_M-pyrifera_M_contig72087.17156.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=222bp AIVLIWPPVWAQAQDITIPSGTTVTTTQEITADGEGVTIEKGGSIDTVASback to top mRNA from alignment at M-pyrifera_M_contig72087:141..806+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig72087.17156.1 ID=mRNA_M-pyrifera_M_contig72087.17156.1|Name=mRNA_M-pyrifera_M_contig72087.17156.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=666bp|location=Sequence derived from alignment at M-pyrifera_M_contig72087:141..806+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig72087:141..806+ >mRNA_M-pyrifera_M_contig72087.17156.1 ID=mRNA_M-pyrifera_M_contig72087.17156.1|Name=mRNA_M-pyrifera_M_contig72087.17156.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1332bp|location=Sequence derived from alignment at M-pyrifera_M_contig72087:141..806+ (Macrocystis pyrifera P11B4 male)back to top |