prot_M-pyrifera_M_contig72087.17156.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72087.17156.1 vs. uniprot
Match: UPI0010A9E817 (autotransporter domain-containing protein n=1 Tax=Nitratireductor sp. XY-223 TaxID=2561926 RepID=UPI0010A9E817) HSP 1 Score: 59.7 bits (143), Expect = 8.430e-7 Identity = 31/63 (49.21%), Postives = 42/63 (66.67%), Query Frame = 0 Query: 11 AQAQDITIPSGTTVTTTQEITADGEGVTIEKGGSIDTVASSVRAVEGTANNQTFTNHGLIDSG 73 A A D+T+ +GTT TTTQ I DG+ +T+E+GG+IDT A+ + V T +NQT N G I G Sbjct: 27 AIAADVTVSTGTTETTTQTIDEDGDTLTVEEGGTIDTTAAGTQGVRATGDNQTVINRGTIKGG 89
BLAST of mRNA_M-pyrifera_M_contig72087.17156.1 vs. uniprot
Match: UPI00145A346A (autotransporter domain-containing protein n=1 Tax=Nitratireductor sp. XY-223 TaxID=2561926 RepID=UPI00145A346A) HSP 1 Score: 58.9 bits (141), Expect = 1.510e-6 Identity = 37/73 (50.68%), Postives = 45/73 (61.64%), Query Frame = 0 Query: 11 AQAQDITIPSGTTVTTTQEITADGEGVTIEKGGSIDTVASS-VRAVEGTANNQTFTNHGLIDSGDTGLRSNGD 82 A A D+TI S TT TTTQ I DG+ +T+E GG IDT A++ VE TA+NQT N G I G+ S GD Sbjct: 42 AGAADVTIDSNTTETTTQTIDEDGDTLTVEDGGIIDTSATADANGVEATADNQTMINDGTITGNKYGIHSYGD 114 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72087.17156.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig72087.17156.1 ID=prot_M-pyrifera_M_contig72087.17156.1|Name=mRNA_M-pyrifera_M_contig72087.17156.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=222bpback to top |