mRNA_M-pyrifera_M_contig70667.16870.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig70667.16870.1 vs. uniprot
Match: A0A6H5LA89_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LA89_9PHAE) HSP 1 Score: 62.4 bits (150), Expect = 3.940e-9 Identity = 34/94 (36.17%), Postives = 52/94 (55.32%), Query Frame = 1 Query: 31 EFRMQKAMSPSGAWKELEDYYMPKTIAATHRLRREFDTIRMAGDENPLLFLGRVDKAADELAMLGCGKSAEEVNRHIVSNLSSLYTIQSKSILS 312 E + S +GAW+ +ED+Y+P A L E D I M+ DE+P LF RV + +L +G KS +EV R +V L + Y ++ ++ LS Sbjct: 178 ENNLYSCHSVAGAWRMMEDWYLPNHPADCQLLVAELDNITMSDDEDPKLFFSRVAQLETKLRAVGIAKSEQEVVRILVRQLPARYDVEKRTSLS 271 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig70667.16870.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig70667.16870.1 >prot_M-pyrifera_M_contig70667.16870.1 ID=prot_M-pyrifera_M_contig70667.16870.1|Name=mRNA_M-pyrifera_M_contig70667.16870.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=105bp MEAMTGYDMAEFRMQKAMSPSGAWKELEDYYMPKTIAATHRLRREFDTIRback to top mRNA from alignment at M-pyrifera_M_contig70667:262..576+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig70667.16870.1 ID=mRNA_M-pyrifera_M_contig70667.16870.1|Name=mRNA_M-pyrifera_M_contig70667.16870.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=315bp|location=Sequence derived from alignment at M-pyrifera_M_contig70667:262..576+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig70667:262..576+ >mRNA_M-pyrifera_M_contig70667.16870.1 ID=mRNA_M-pyrifera_M_contig70667.16870.1|Name=mRNA_M-pyrifera_M_contig70667.16870.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=630bp|location=Sequence derived from alignment at M-pyrifera_M_contig70667:262..576+ (Macrocystis pyrifera P11B4 male)back to top |