prot_M-pyrifera_M_contig70667.16870.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig70667.16870.1 vs. uniprot
Match: A0A6H5LA89_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LA89_9PHAE) HSP 1 Score: 62.4 bits (150), Expect = 3.940e-9 Identity = 34/94 (36.17%), Postives = 52/94 (55.32%), Query Frame = 0 Query: 11 EFRMQKAMSPSGAWKELEDYYMPKTIAATHRLRREFDTIRMAGDENPLLFLGRVDKAADELAMLGCGKSAEEVNRHIVSNLSSLYTIQSKSILS 104 E + S +GAW+ +ED+Y+P A L E D I M+ DE+P LF RV + +L +G KS +EV R +V L + Y ++ ++ LS Sbjct: 178 ENNLYSCHSVAGAWRMMEDWYLPNHPADCQLLVAELDNITMSDDEDPKLFFSRVAQLETKLRAVGIAKSEQEVVRILVRQLPARYDVEKRTSLS 271 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig70667.16870.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig70667.16870.1 ID=prot_M-pyrifera_M_contig70667.16870.1|Name=mRNA_M-pyrifera_M_contig70667.16870.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=105bpback to top |