mRNA_M-pyrifera_M_contig104568.983.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104568.983.1 vs. uniprot
Match: UPI001485E4DB (S8 family serine peptidase n=1 Tax=Roseovarius arcticus TaxID=2547404 RepID=UPI001485E4DB) HSP 1 Score: 72.0 bits (175), Expect = 4.130e-12 Identity = 36/100 (36.00%), Postives = 61/100 (61.00%), Query Frame = 1 Query: 91 DALFLTLYNTGRLPLKSVVINKGEYPGDTMRRAGAWVG-NLSASSDVLLCDLNPRICSRSRQTAGSRELRRETTHLAGFKMGGSP-RWKASAGNRLIVPD 384 + L+L+L+N+G L L++V +++ + +R + G + S D ++CDLNP++CSR+ A +L T+H+ GF SP RW+ S GN ++VPD Sbjct: 45 ETLYLSLFNSGNLTLRTVKMDQSPFVEHVLRNEKLFFGAHFPQSIDAMMCDLNPKLCSRTLTGAPQSQLSDLTSHVGGF--AASPGRWRTSVGNTIVVPD 142
BLAST of mRNA_M-pyrifera_M_contig104568.983.1 vs. uniprot
Match: UPI00110F4911 (S8 family serine peptidase n=1 Tax=unclassified Bradyrhizobium TaxID=2631580 RepID=UPI00110F4911) HSP 1 Score: 52.8 bits (125), Expect = 2.210e-5 Identity = 32/100 (32.00%), Postives = 56/100 (56.00%), Query Frame = 1 Query: 97 LFLTLYNTGRLPLKSVVINKGEYPGDTMRRAGAWVGNLSASS-DVLLCDLNPRICSRSRQTAGSRELRRETTHLAGFKMGGSPRWKASAG-NRLIVPDIL 390 ++LTLYN+ RL +KSV ++ +R+ + G + D ++CDLN IC+R R A + + T++++GF + RW+ N+L VPD++ Sbjct: 92 IYLTLYNSKRLSVKSVETSEHTVEA-VLRKERLFYGKFFPTEIDSMICDLNSDICNRERTEATGEQRQSLTSNVSGF-LPSETRWRLEPPVNKLWVPDVV 189 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104568.983.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig104568.983.1 >prot_M-pyrifera_M_contig104568.983.1 ID=prot_M-pyrifera_M_contig104568.983.1|Name=mRNA_M-pyrifera_M_contig104568.983.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=125bp MLAAQNAEITWSARAASDSDATSAQDALFLTLYNTGRLPLKSVVINKGEYback to top mRNA from alignment at M-pyrifera_M_contig104568:196..585- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig104568.983.1 ID=mRNA_M-pyrifera_M_contig104568.983.1|Name=mRNA_M-pyrifera_M_contig104568.983.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=390bp|location=Sequence derived from alignment at M-pyrifera_M_contig104568:196..585- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig104568:196..585- >mRNA_M-pyrifera_M_contig104568.983.1 ID=mRNA_M-pyrifera_M_contig104568.983.1|Name=mRNA_M-pyrifera_M_contig104568.983.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=750bp|location=Sequence derived from alignment at M-pyrifera_M_contig104568:196..585- (Macrocystis pyrifera P11B4 male)back to top |