prot_M-pyrifera_M_contig104568.983.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104568.983.1 vs. uniprot
Match: UPI001485E4DB (S8 family serine peptidase n=1 Tax=Roseovarius arcticus TaxID=2547404 RepID=UPI001485E4DB) HSP 1 Score: 72.0 bits (175), Expect = 3.490e-12 Identity = 36/100 (36.00%), Postives = 61/100 (61.00%), Query Frame = 0 Query: 26 DALFLTLYNTGRLPLKSVVINKGEYPGDTMRRAGAWVG-NLSASSDVLLCDLNPRICSRSRQTAGSRELRRETTHLAGFKMGGSP-RWKASAGNRLIVPD 123 + L+L+L+N+G L L++V +++ + +R + G + S D ++CDLNP++CSR+ A +L T+H+ GF SP RW+ S GN ++VPD Sbjct: 45 ETLYLSLFNSGNLTLRTVKMDQSPFVEHVLRNEKLFFGAHFPQSIDAMMCDLNPKLCSRTLTGAPQSQLSDLTSHVGGF--AASPGRWRTSVGNTIVVPD 142
BLAST of mRNA_M-pyrifera_M_contig104568.983.1 vs. uniprot
Match: UPI00110F4911 (S8 family serine peptidase n=1 Tax=unclassified Bradyrhizobium TaxID=2631580 RepID=UPI00110F4911) HSP 1 Score: 52.8 bits (125), Expect = 1.900e-5 Identity = 32/100 (32.00%), Postives = 56/100 (56.00%), Query Frame = 0 Query: 28 LFLTLYNTGRLPLKSVVINKGEYPGDTMRRAGAWVGNLSASS-DVLLCDLNPRICSRSRQTAGSRELRRETTHLAGFKMGGSPRWKASAG-NRLIVPDIL 125 ++LTLYN+ RL +KSV ++ +R+ + G + D ++CDLN IC+R R A + + T++++GF + RW+ N+L VPD++ Sbjct: 92 IYLTLYNSKRLSVKSVETSEHTVEA-VLRKERLFYGKFFPTEIDSMICDLNSDICNRERTEATGEQRQSLTSNVSGF-LPSETRWRLEPPVNKLWVPDVV 189 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104568.983.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig104568.983.1 ID=prot_M-pyrifera_M_contig104568.983.1|Name=mRNA_M-pyrifera_M_contig104568.983.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=125bpback to top |