mRNA_M-pyrifera_M_contig104470.963.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104470.963.1 vs. uniprot
Match: A0A517P908_9PLAN (Uncharacterized protein n=1 Tax=Alienimonas californiensis TaxID=2527989 RepID=A0A517P908_9PLAN) HSP 1 Score: 67.0 bits (162), Expect = 1.710e-9 Identity = 39/72 (54.17%), Postives = 45/72 (62.50%), Query Frame = 1 Query: 400 VTKTVPGPVIIKHVQTPGRYRYNRNTCCCEYVPGRCRKVRCQGCPQTVCCKVCCPKCVKKEVCCTRMVPECC 615 V +TVPGP+I K VQ PGR YN TC EY R V C G +T+ +VCCPK V+KEV CTR V E C Sbjct: 235 VQRTVPGPMIRKTVQEPGRCVYNPQTCRYEYXXXXXRTVCCPGPERTIXEQVCCPKVVQKEVSCTRYVSEVC 306 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104470.963.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig104470.963.1 >prot_M-pyrifera_M_contig104470.963.1 ID=prot_M-pyrifera_M_contig104470.963.1|Name=mRNA_M-pyrifera_M_contig104470.963.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=206bp TCHRTVYDTCYKEVPYTVCKPVHTTCYKQCCYQVRVPHYQTCYRTVTCNIback to top mRNA from alignment at M-pyrifera_M_contig104470:3..620- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig104470.963.1 ID=mRNA_M-pyrifera_M_contig104470.963.1|Name=mRNA_M-pyrifera_M_contig104470.963.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=618bp|location=Sequence derived from alignment at M-pyrifera_M_contig104470:3..620- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig104470:3..620- >mRNA_M-pyrifera_M_contig104470.963.1 ID=mRNA_M-pyrifera_M_contig104470.963.1|Name=mRNA_M-pyrifera_M_contig104470.963.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1236bp|location=Sequence derived from alignment at M-pyrifera_M_contig104470:3..620- (Macrocystis pyrifera P11B4 male)back to top |