prot_M-pyrifera_M_contig104470.963.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104470.963.1 vs. uniprot
Match: A0A517ZBT2_9PLAN (Uncharacterized protein n=2 Tax=Maioricimonas rarisocia TaxID=2528026 RepID=A0A517ZBT2_9PLAN) HSP 1 Score: 68.9 bits (167), Expect = 3.670e-10 Identity = 38/72 (52.78%), Postives = 50/72 (69.44%), Query Frame = 0 Query: 134 VTKTVPGPVIIKHVQTPGRYRYNRNTCCCEYVPGRCR--KVRCQGCPQTVCCKVCCPKCVKKEVCCTRMVPE 203 V++ VPGPV+ + VQ PG + ++ N CCC Y PG CR KV+C G +TVC +V CPK V+K+V CTR V E Sbjct: 221 VSEYVPGPVVERCVQDPGSFVWDPNGCCCVYKPGCCRVEKVQCPG--RTVCRRVWCPKVVQKQVTCTRYVNE 290
BLAST of mRNA_M-pyrifera_M_contig104470.963.1 vs. uniprot
Match: A0A517P908_9PLAN (Uncharacterized protein n=1 Tax=Alienimonas californiensis TaxID=2527989 RepID=A0A517P908_9PLAN) HSP 1 Score: 67.0 bits (162), Expect = 1.710e-9 Identity = 39/72 (54.17%), Postives = 45/72 (62.50%), Query Frame = 0 Query: 134 VTKTVPGPVIIKHVQTPGRYRYNRNTCCCEYVPGRCRKVRCQGCPQTVCCKVCCPKCVKKEVCCTRMVPECC 205 V +TVPGP+I K VQ PGR YN TC EY R V C G +T+ +VCCPK V+KEV CTR V E C Sbjct: 235 VQRTVPGPMIRKTVQEPGRCVYNPQTCRYEYXXXXXRTVCCPGPERTIXEQVCCPKVVQKEVSCTRYVSEVC 306 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104470.963.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig104470.963.1 ID=prot_M-pyrifera_M_contig104470.963.1|Name=mRNA_M-pyrifera_M_contig104470.963.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=206bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|