mRNA_M-pyrifera_M_contig104463.960.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104463.960.1 vs. uniprot
Match: A0A078B620_STYLE (PAP-associated domain-containing protein n=1 Tax=Stylonychia lemnae TaxID=5949 RepID=A0A078B620_STYLE) HSP 1 Score: 51.2 bits (121), Expect = 9.960e-6 Identity = 30/100 (30.00%), Postives = 53/100 (53.00%), Query Frame = 1 Query: 1 GGLDRVSGLNLGFLLYLFFDYFGRRHNYHRVGLSLSPQEPAMQDKGSMGKAFRNVEDPGSLAFKSPLEADANLGGAAFQIQRVMRAWQLAAESLDFGIDN 300 GG D++ LG L F + +G + NY +G+S+ + K G + L+ ++P +++ ++GG+AF I+RV RA+Q A ++L F N Sbjct: 42 GGTDKID---LGRHLIDFLELYGTKFNYEDIGISIR-DDGFYYQKSKRGWQGYDERTRSKLSVENPQDSEVDIGGSAFNIKRVQRAFQHAYDTLIFNNSN 137
BLAST of mRNA_M-pyrifera_M_contig104463.960.1 vs. uniprot
Match: J9I2X3_9SPIT (Poly(A) RNA polymerase putative n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9I2X3_9SPIT) HSP 1 Score: 51.6 bits (122), Expect = 1.880e-5 Identity = 33/100 (33.00%), Postives = 54/100 (54.00%), Query Frame = 1 Query: 7 LDRVSGLNLGFLLYLFFDYFGRRHNYHRVGLSLSPQEPAMQD--KGSMGKAFRNVEDPGSLAFKSPLEADANLGGAAFQIQRVMRAWQLAAESLDFGIDN 300 L + L+LG L FF +G NY VG+S+ Q +G G+ R+ E L+ ++P + + ++GG+AF I+RV RA+Q A ++L + N Sbjct: 195 LGNTNNLDLGKQLLDFFKLYGTEFNYQHVGISIRDGGFYYQKYKRGWEGRDERSYE---RLSVENPQDPEVDIGGSAFNIKRVQRAFQHAYDTLIYNNSN 291
BLAST of mRNA_M-pyrifera_M_contig104463.960.1 vs. uniprot
Match: A0A8J8T226_HALGN (Uncharacterized protein n=1 Tax=Halteria grandinella TaxID=5974 RepID=A0A8J8T226_HALGN) HSP 1 Score: 51.6 bits (122), Expect = 1.970e-5 Identity = 30/99 (30.30%), Postives = 55/99 (55.56%), Query Frame = 1 Query: 4 GLDRVSGLNLGFLLYLFFDYFGRRHNYHRVGLSLSPQEPAMQDKGSMGKAFRNVEDPGSLAFKSPLEADANLGGAAFQIQRVMRAWQLAAESLDFGIDN 300 G + ++LG L FF+++G + NY VG+S+ +E K + G + L+ ++P + D ++GG+A+ I++V RA+Q A ++L F N Sbjct: 234 GGGKTEKIDLGKHLIDFFEFYGTKFNYEDVGISIR-EEGFYFPKRNRGWEGYDERSRYRLSVENPQDPDVDIGGSAYNIRKVQRAFQHAYDTLIFNNSN 331 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104463.960.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig104463.960.1 >prot_M-pyrifera_M_contig104463.960.1 ID=prot_M-pyrifera_M_contig104463.960.1|Name=mRNA_M-pyrifera_M_contig104463.960.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=100bp GGLDRVSGLNLGFLLYLFFDYFGRRHNYHRVGLSLSPQEPAMQDKGSMGKback to top mRNA from alignment at M-pyrifera_M_contig104463:164..463+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig104463.960.1 ID=mRNA_M-pyrifera_M_contig104463.960.1|Name=mRNA_M-pyrifera_M_contig104463.960.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=300bp|location=Sequence derived from alignment at M-pyrifera_M_contig104463:164..463+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig104463:164..463+ >mRNA_M-pyrifera_M_contig104463.960.1 ID=mRNA_M-pyrifera_M_contig104463.960.1|Name=mRNA_M-pyrifera_M_contig104463.960.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=600bp|location=Sequence derived from alignment at M-pyrifera_M_contig104463:164..463+ (Macrocystis pyrifera P11B4 male)back to top |