mRNA_M-pyrifera_M_contig103967.842.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103967.842.1 vs. uniprot
Match: A0A1Y1HXU4_KLENI (Uncharacterized protein n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1HXU4_KLENI) HSP 1 Score: 83.2 bits (204), Expect = 5.230e-15 Identity = 39/94 (41.49%), Postives = 56/94 (59.57%), Query Frame = 1 Query: 310 RCTTSSEPGRWLGILDKTTPCEPPVCSGDRVQSMVTAQSWMGAIYDYVWVPYNCYFHLYSPNDISYCAREAGISWIHVMGDSLSREMEAYLASV 591 RC +PGRWL L C PP CSG+R + V + W G +V+ P+ C +H++S DI+ CA E G+ W+HV+GDS RE+ + L S+ Sbjct: 893 RCVEGDKPGRWLN-LPVAENCRPPFCSGNRSATNVVKE-WNGNDIPWVYAPFGCQYHMFSLGDITTCAGETGVKWVHVVGDSTVREIPSTLFSM 984 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103967.842.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig103967.842.1 >prot_M-pyrifera_M_contig103967.842.1 ID=prot_M-pyrifera_M_contig103967.842.1|Name=mRNA_M-pyrifera_M_contig103967.842.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=202bp LLSHDVIQSAPVSSHWNREWGGYELDVTIRDVGMYKLRVTLNEIWGSSEPback to top mRNA from alignment at M-pyrifera_M_contig103967:3..608+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig103967.842.1 ID=mRNA_M-pyrifera_M_contig103967.842.1|Name=mRNA_M-pyrifera_M_contig103967.842.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=606bp|location=Sequence derived from alignment at M-pyrifera_M_contig103967:3..608+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig103967:3..608+ >mRNA_M-pyrifera_M_contig103967.842.1 ID=mRNA_M-pyrifera_M_contig103967.842.1|Name=mRNA_M-pyrifera_M_contig103967.842.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1212bp|location=Sequence derived from alignment at M-pyrifera_M_contig103967:3..608+ (Macrocystis pyrifera P11B4 male)back to top |