mRNA_M-pyrifera_M_contig103822.814.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103822.814.1 vs. uniprot
Match: A0A7Y2IJ16_9ACTN (Uncharacterized protein n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A7Y2IJ16_9ACTN) HSP 1 Score: 61.6 bits (148), Expect = 2.570e-9 Identity = 36/105 (34.29%), Postives = 57/105 (54.29%), Query Frame = 1 Query: 25 VLSSACGEDEFPPQVKQDAEIYEAALNHLVEVSGVELADNWVDPVVFVEVLDTTEVDLETQVAVIDEMDEAFAIRFVDDLGEAIDIELDDLPVREGTILIAFGPI 339 VL +AC P +DA Y A ++ L++ S ++ D PV++VE + L QV ++ + + +RFVDD GEA+ ++L+ PVR + LI GPI Sbjct: 25 VLVTACSSQPKPETTDRDASAYAAVIDALLQGSPLDQEDPDRLPVIYVEAFAQEGISLTVQVQLVTAYADTYQLRFVDDRGEALLVDLEKQPVRSSSALIGLGPI 129 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103822.814.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig103822.814.1 >prot_M-pyrifera_M_contig103822.814.1 ID=prot_M-pyrifera_M_contig103822.814.1|Name=mRNA_M-pyrifera_M_contig103822.814.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=118bp LLAFALISVLSSACGEDEFPPQVKQDAEIYEAALNHLVEVSGVELADNWVback to top mRNA from alignment at M-pyrifera_M_contig103822:124..477- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig103822.814.1 ID=mRNA_M-pyrifera_M_contig103822.814.1|Name=mRNA_M-pyrifera_M_contig103822.814.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=354bp|location=Sequence derived from alignment at M-pyrifera_M_contig103822:124..477- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig103822:124..477- >mRNA_M-pyrifera_M_contig103822.814.1 ID=mRNA_M-pyrifera_M_contig103822.814.1|Name=mRNA_M-pyrifera_M_contig103822.814.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=708bp|location=Sequence derived from alignment at M-pyrifera_M_contig103822:124..477- (Macrocystis pyrifera P11B4 male)back to top |