mRNA_M-pyrifera_M_contig103752.804.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103752.804.1 vs. uniprot
Match: A0A667ZST2_9TELE (Plakophilin 3 n=6 Tax=Myripristis murdjan TaxID=586833 RepID=A0A667ZST2_9TELE) HSP 1 Score: 55.5 bits (132), Expect = 9.310e-6 Identity = 29/66 (43.94%), Postives = 43/66 (65.15%), Query Frame = 1 Query: 289 ARDEAR--KAIPSLLQLAQCDNPVLRAHAAGALLNLCIQNISNRVALRDAGGISVLVENVREGSDE 480 A+DE R K I L++L CDN ++ +A GA NL +N+ N+VAL + GGI+ L+E ++E DE Sbjct: 381 AKDEVRRYKGISELVRLFNCDNQEVQRYATGATRNLIYENMDNKVALIEEGGIAQLIEALKENDDE 446
BLAST of mRNA_M-pyrifera_M_contig103752.804.1 vs. uniprot
Match: A0A8J7NUX7_ATRSP (PKP3 protein (Fragment) n=1 Tax=Atractosteus spatula TaxID=7917 RepID=A0A8J7NUX7_ATRSP) HSP 1 Score: 53.1 bits (126), Expect = 5.890e-5 Identity = 31/79 (39.24%), Postives = 52/79 (65.82%), Query Frame = 1 Query: 250 AAALRNVIAEHAGARDEAR--KAIPSLLQLAQCDNPVLRAHAAGALLNLCIQNISNRVALRDAGGISVLVENVREGSDE 480 AA +++ ++ A+ +AR KAIP+L++L D+ ++ +A GA+ NL +N+ N+ AL +AGGI L+E +RE DE Sbjct: 437 AAYIQHECYHNSDAKTQARQLKAIPALVKLFNSDSQDVQRYATGAMRNLIYENLDNKSALIEAGGIPQLIEALREPDDE 515
BLAST of mRNA_M-pyrifera_M_contig103752.804.1 vs. uniprot
Match: A0A484D2R6_PERFV (Uncharacterized protein n=19 Tax=Percidae TaxID=8165 RepID=A0A484D2R6_PERFV) HSP 1 Score: 52.8 bits (125), Expect = 7.840e-5 Identity = 29/66 (43.94%), Postives = 42/66 (63.64%), Query Frame = 1 Query: 289 ARDEAR--KAIPSLLQLAQCDNPVLRAHAAGALLNLCIQNISNRVALRDAGGISVLVENVREGSDE 480 A++E R K I L++L CDN ++ +A GA NL +N+ N+VAL + GGI LVE ++E DE Sbjct: 408 AKNEVRRLKGIGELVRLFNCDNQEVQRYATGATRNLIYENMDNKVALIEEGGIPQLVEALKESDDE 473
BLAST of mRNA_M-pyrifera_M_contig103752.804.1 vs. uniprot
Match: A0A556TLA6_BAGYA (Plakophilin-3 n=1 Tax=Bagarius yarrelli TaxID=175774 RepID=A0A556TLA6_BAGYA) HSP 1 Score: 52.8 bits (125), Expect = 7.990e-5 Identity = 30/71 (42.25%), Postives = 44/71 (61.97%), Query Frame = 1 Query: 307 KAIPSLLQLAQCDNPVLRAHAAGALLNLCIQNISNRVALRDAGGISVLVENVREGSDEGRTDAALALQLLA 519 KAIP+L+QL +N ++ +A GA NL +N+ N+ AL +AGGIS LV ++E DE R + L L+ Sbjct: 544 KAIPALVQLYSSENQEVQRYATGATRNLIYENMENKTALIEAGGISKLVSALKELDDELRKNVTGILWNLS 614 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103752.804.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig103752.804.1 >prot_M-pyrifera_M_contig103752.804.1 ID=prot_M-pyrifera_M_contig103752.804.1|Name=mRNA_M-pyrifera_M_contig103752.804.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=170bp MRATCGLKVPVARIQQILQALKKHEKSDHGPALAQVLWVLSRNTENCLSIback to top mRNA from alignment at M-pyrifera_M_contig103752:87..620+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig103752.804.1 ID=mRNA_M-pyrifera_M_contig103752.804.1|Name=mRNA_M-pyrifera_M_contig103752.804.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=534bp|location=Sequence derived from alignment at M-pyrifera_M_contig103752:87..620+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig103752:87..620+ >mRNA_M-pyrifera_M_contig103752.804.1 ID=mRNA_M-pyrifera_M_contig103752.804.1|Name=mRNA_M-pyrifera_M_contig103752.804.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1020bp|location=Sequence derived from alignment at M-pyrifera_M_contig103752:87..620+ (Macrocystis pyrifera P11B4 male)back to top |