mRNA_M-pyrifera_M_contig101987.427.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig101987.427.1 vs. uniprot
Match: A0A4P9Y227_9FUNG (Uncharacterized protein (Fragment) n=1 Tax=Piptocephalis cylindrospora TaxID=1907219 RepID=A0A4P9Y227_9FUNG) HSP 1 Score: 51.2 bits (121), Expect = 1.940e-5 Identity = 42/113 (37.17%), Postives = 57/113 (50.44%), Query Frame = 1 Query: 4 LTHLPDELGFCRRLRVLHVQR----NRLQTLPTTF-ASLHRLEEMDVSHNELTWVPEQLLNVDESLADALAQGKVSLEAIEGETRGCLSLRSLDLSHNCLTALPLSLCKCKTL 327 L HLP LG C RLR+L + N L +LP + +SL LEE+D+S N LT +P+ LA L+LRSLD+S N L +LP +L +C+ L Sbjct: 18 LPHLPRSLGQCTRLRILRLGSVYGGNLLTSLPDSLISSLPHLEELDLSGNHLTHLPD------------LAWP--------------LTLRSLDVSDNSLISLPSNLGQCQRL 104
BLAST of mRNA_M-pyrifera_M_contig101987.427.1 vs. uniprot
Match: A0A8B0LN27_THAMO (Toll-like receptor 7 n=1 Tax=Thamnaconus modestus TaxID=325629 RepID=A0A8B0LN27_THAMO) HSP 1 Score: 50.8 bits (120), Expect = 8.860e-5 Identity = 33/96 (34.38%), Postives = 51/96 (53.12%), Query Frame = 1 Query: 94 FASLHRLEEMDVSHNELTWVPEQLLNVDESLADALAQGKVSLEAIEGETRGCL----SLRSLDLSHNCLTALPLSLCKC-KTLACFYVHDNPFLLL 366 F LH L +D+SHN L ++P+Q+ + L D L++ + ++ G L S+R LDLS N LT +P L C ++L+ +H N L L Sbjct: 651 FRKLHNLTHLDISHNNLNFIPQQVFS---GLPDKLSELYIKNNKLKSFAWGKLQLLPSIRILDLSGNSLTTVPRELSNCSRSLSKLILHKNQILKL 743 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig101987.427.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig101987.427.1 >prot_M-pyrifera_M_contig101987.427.1 ID=prot_M-pyrifera_M_contig101987.427.1|Name=mRNA_M-pyrifera_M_contig101987.427.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=124bp DLTHLPDELGFCRRLRVLHVQRNRLQTLPTTFASLHRLEEMDVSHNELTWback to top mRNA from alignment at M-pyrifera_M_contig101987:3..374+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig101987.427.1 ID=mRNA_M-pyrifera_M_contig101987.427.1|Name=mRNA_M-pyrifera_M_contig101987.427.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=372bp|location=Sequence derived from alignment at M-pyrifera_M_contig101987:3..374+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig101987:3..374+ >mRNA_M-pyrifera_M_contig101987.427.1 ID=mRNA_M-pyrifera_M_contig101987.427.1|Name=mRNA_M-pyrifera_M_contig101987.427.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=744bp|location=Sequence derived from alignment at M-pyrifera_M_contig101987:3..374+ (Macrocystis pyrifera P11B4 male)back to top |