prot_M-pyrifera_M_contig101987.427.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig101987.427.1 vs. uniprot
Match: A0A4P9Y227_9FUNG (Uncharacterized protein (Fragment) n=1 Tax=Piptocephalis cylindrospora TaxID=1907219 RepID=A0A4P9Y227_9FUNG) HSP 1 Score: 51.2 bits (121), Expect = 1.940e-5 Identity = 42/113 (37.17%), Postives = 57/113 (50.44%), Query Frame = 0 Query: 2 LTHLPDELGFCRRLRVLHVQR----NRLQTLPTTF-ASLHRLEEMDVSHNELTWVPEQLLNVDESLADALAQGKVSLEAIEGETRGCLSLRSLDLSHNCLTALPLSLCKCKTL 109 L HLP LG C RLR+L + N L +LP + +SL LEE+D+S N LT +P+ LA L+LRSLD+S N L +LP +L +C+ L Sbjct: 18 LPHLPRSLGQCTRLRILRLGSVYGGNLLTSLPDSLISSLPHLEELDLSGNHLTHLPD------------LAWP--------------LTLRSLDVSDNSLISLPSNLGQCQRL 104 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig101987.427.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig101987.427.1 ID=prot_M-pyrifera_M_contig101987.427.1|Name=mRNA_M-pyrifera_M_contig101987.427.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=124bpback to top |