mRNA_M-pyrifera_M_contig101913.411.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig101913.411.1 vs. uniprot
Match: A0A6A5NPJ1_LUPAL (Putative thioredoxin-like, endoplasmic reticulum vesicle transporter n=2 Tax=Lupinus TaxID=3869 RepID=A0A6A5NPJ1_LUPAL) HSP 1 Score: 54.7 bits (130), Expect = 7.810e-7 Identity = 27/84 (32.14%), Postives = 43/84 (51.19%), Query Frame = 1 Query: 1 GVVTPEYEHSALTEEERAHGAFEATGGSLREYLDSHTLVAVAFTASWCSHCQVLKPTWDKVASDLRA-----YDEHVRLARVEC 237 G V +H +EE G+ T + +Y+ + V F A WCS CQ LKP+W+KVA+ ++ D + +A+V+C Sbjct: 123 GTVANAVKHDDEVDEESVEGSLSLTEHNFNKYIHQFPITVVNFYAPWCSWCQRLKPSWEKVANIIKERYDPEIDGRILVAKVDC 206
BLAST of mRNA_M-pyrifera_M_contig101913.411.1 vs. uniprot
Match: G8Y527_PICSO (Piso0_005426 protein n=2 Tax=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) TaxID=559304 RepID=G8Y527_PICSO) HSP 1 Score: 51.2 bits (121), Expect = 1.280e-5 Identity = 20/37 (54.05%), Postives = 29/37 (78.38%), Query Frame = 1 Query: 121 VAFTASWCSHCQVLKPTWDKVASDLRAYDEHVRLARV 231 VAFTASWC HC+ LKP W+K+A+ + DE +++A+V Sbjct: 168 VAFTASWCPHCERLKPVWEKLANVIFDRDEQIKIAQV 204
BLAST of mRNA_M-pyrifera_M_contig101913.411.1 vs. uniprot
Match: A0A8K0KG75_LADFU (Uncharacterized protein n=1 Tax=Ladona fulva TaxID=123851 RepID=A0A8K0KG75_LADFU) HSP 1 Score: 48.9 bits (115), Expect = 8.440e-5 Identity = 19/39 (48.72%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 121 VAFTASWCSHCQVLKPTWDKVASDLRAYDEHVRLARVEC 237 V F A WC+HCQ L PTW+K+A L +Y+E V +++++C Sbjct: 198 VKFYAPWCTHCQRLAPTWEKLAESL-SYEEGVSISKIDC 235 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig101913.411.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig101913.411.1 >prot_M-pyrifera_M_contig101913.411.1 ID=prot_M-pyrifera_M_contig101913.411.1|Name=mRNA_M-pyrifera_M_contig101913.411.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=79bp GVVTPEYEHSALTEEERAHGAFEATGGSLREYLDSHTLVAVAFTASWCSHback to top mRNA from alignment at M-pyrifera_M_contig101913:430..666+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig101913.411.1 ID=mRNA_M-pyrifera_M_contig101913.411.1|Name=mRNA_M-pyrifera_M_contig101913.411.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=237bp|location=Sequence derived from alignment at M-pyrifera_M_contig101913:430..666+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig101913:430..666+ >mRNA_M-pyrifera_M_contig101913.411.1 ID=mRNA_M-pyrifera_M_contig101913.411.1|Name=mRNA_M-pyrifera_M_contig101913.411.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=474bp|location=Sequence derived from alignment at M-pyrifera_M_contig101913:430..666+ (Macrocystis pyrifera P11B4 male)back to top |