mRNA_M-pyrifera_M_contig101906.406.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig101906.406.1 vs. uniprot
Match: A0A8J5RBF8_ZIZPA (Uncharacterized protein n=2 Tax=Zizania palustris TaxID=103762 RepID=A0A8J5RBF8_ZIZPA) HSP 1 Score: 48.5 bits (114), Expect = 7.000e-5 Identity = 28/63 (44.44%), Postives = 34/63 (53.97%), Query Frame = 1 Query: 28 EDKSPYTPPVFSELDIGLQASFHRFLIDLGVGDEFADAVRAVADQKEHFEYLRWLKKVHAAIS 216 EDK Y PVF LD LQ F R+L GV + A +VR QKEH +Y+ WLK + S Sbjct: 159 EDK--YEGPVFRYLDPRLQLIFDRYLQARGVNSKLASSVRHHLIQKEHVQYVSWLKSLEEMFS 219 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig101906.406.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig101906.406.1 >prot_M-pyrifera_M_contig101906.406.1 ID=prot_M-pyrifera_M_contig101906.406.1|Name=mRNA_M-pyrifera_M_contig101906.406.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=73bp PRGTDPRSIEDKSPYTPPVFSELDIGLQASFHRFLIDLGVGDEFADAVRAback to top mRNA from alignment at M-pyrifera_M_contig101906:327..545- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig101906.406.1 ID=mRNA_M-pyrifera_M_contig101906.406.1|Name=mRNA_M-pyrifera_M_contig101906.406.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=219bp|location=Sequence derived from alignment at M-pyrifera_M_contig101906:327..545- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig101906:327..545- >mRNA_M-pyrifera_M_contig101906.406.1 ID=mRNA_M-pyrifera_M_contig101906.406.1|Name=mRNA_M-pyrifera_M_contig101906.406.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=438bp|location=Sequence derived from alignment at M-pyrifera_M_contig101906:327..545- (Macrocystis pyrifera P11B4 male)back to top |