prot_M-pyrifera_M_contig101906.406.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig101906.406.1 vs. uniprot
Match: A0A8J5RBF8_ZIZPA (Uncharacterized protein n=2 Tax=Zizania palustris TaxID=103762 RepID=A0A8J5RBF8_ZIZPA) HSP 1 Score: 48.5 bits (114), Expect = 7.000e-5 Identity = 28/63 (44.44%), Postives = 34/63 (53.97%), Query Frame = 0 Query: 10 EDKSPYTPPVFSELDIGLQASFHRFLIDLGVGDEFADAVRAVADQKEHFEYLRWLKKVHAAIS 72 EDK Y PVF LD LQ F R+L GV + A +VR QKEH +Y+ WLK + S Sbjct: 159 EDK--YEGPVFRYLDPRLQLIFDRYLQARGVNSKLASSVRHHLIQKEHVQYVSWLKSLEEMFS 219 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig101906.406.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig101906.406.1 ID=prot_M-pyrifera_M_contig101906.406.1|Name=mRNA_M-pyrifera_M_contig101906.406.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=73bpback to top |