mRNA_M-pyrifera_M_contig10185.392.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig10185.392.1 vs. uniprot
Match: D8LH24_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LH24_ECTSI) HSP 1 Score: 90.9 bits (224), Expect = 6.340e-20 Identity = 42/52 (80.77%), Postives = 46/52 (88.46%), Query Frame = 1 Query: 22 DDVVVSRVELDCRAYHHRKHWQESVLPRLYEFARMVYRFRDDHMLRFRYLLA 177 DDV+VSRVELDCR Y HRKHW + VLPRLYEFARMVYRFR D +LR+RYLLA Sbjct: 566 DDVLVSRVELDCRTYRHRKHWGQVVLPRLYEFARMVYRFRGDDLLRWRYLLA 617
BLAST of mRNA_M-pyrifera_M_contig10185.392.1 vs. uniprot
Match: A0A6H5JME7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JME7_9PHAE) HSP 1 Score: 90.9 bits (224), Expect = 6.350e-20 Identity = 42/52 (80.77%), Postives = 46/52 (88.46%), Query Frame = 1 Query: 22 DDVVVSRVELDCRAYHHRKHWQESVLPRLYEFARMVYRFRDDHMLRFRYLLA 177 DDV+VSRVELDCR Y HRKHW + VLPRLYEFARMVYRFR D +LR+RYLLA Sbjct: 603 DDVLVSRVELDCRTYRHRKHWGQVVLPRLYEFARMVYRFRGDDLLRWRYLLA 654 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig10185.392.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig10185.392.1 >prot_M-pyrifera_M_contig10185.392.1 ID=prot_M-pyrifera_M_contig10185.392.1|Name=mRNA_M-pyrifera_M_contig10185.392.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=59bp MAQAPKEDDVVVSRVELDCRAYHHRKHWQESVLPRLYEFARMVYRFRDDHback to top mRNA from alignment at M-pyrifera_M_contig10185:117..293+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig10185.392.1 ID=mRNA_M-pyrifera_M_contig10185.392.1|Name=mRNA_M-pyrifera_M_contig10185.392.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=177bp|location=Sequence derived from alignment at M-pyrifera_M_contig10185:117..293+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig10185:117..293+ >mRNA_M-pyrifera_M_contig10185.392.1 ID=mRNA_M-pyrifera_M_contig10185.392.1|Name=mRNA_M-pyrifera_M_contig10185.392.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=354bp|location=Sequence derived from alignment at M-pyrifera_M_contig10185:117..293+ (Macrocystis pyrifera P11B4 male)back to top |