prot_M-pyrifera_M_contig10185.392.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig10185.392.1 vs. uniprot
Match: D8LH24_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LH24_ECTSI) HSP 1 Score: 90.9 bits (224), Expect = 6.340e-20 Identity = 42/52 (80.77%), Postives = 46/52 (88.46%), Query Frame = 0 Query: 8 DDVVVSRVELDCRAYHHRKHWQESVLPRLYEFARMVYRFRDDHMLRFRYLLA 59 DDV+VSRVELDCR Y HRKHW + VLPRLYEFARMVYRFR D +LR+RYLLA Sbjct: 566 DDVLVSRVELDCRTYRHRKHWGQVVLPRLYEFARMVYRFRGDDLLRWRYLLA 617
BLAST of mRNA_M-pyrifera_M_contig10185.392.1 vs. uniprot
Match: A0A6H5JME7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JME7_9PHAE) HSP 1 Score: 90.9 bits (224), Expect = 6.350e-20 Identity = 42/52 (80.77%), Postives = 46/52 (88.46%), Query Frame = 0 Query: 8 DDVVVSRVELDCRAYHHRKHWQESVLPRLYEFARMVYRFRDDHMLRFRYLLA 59 DDV+VSRVELDCR Y HRKHW + VLPRLYEFARMVYRFR D +LR+RYLLA Sbjct: 603 DDVLVSRVELDCRTYRHRKHWGQVVLPRLYEFARMVYRFRGDDLLRWRYLLA 654 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig10185.392.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig10185.392.1 ID=prot_M-pyrifera_M_contig10185.392.1|Name=mRNA_M-pyrifera_M_contig10185.392.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=59bpback to top |