prot_L-elsbetiae_contig16676.4500.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig16676.4500.1 vs. uniprot
Match: A0A6H5JRN5_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JRN5_9PHAE) HSP 1 Score: 77.8 bits (190), Expect = 8.700e-16 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0 Query: 1 APITRQGYLYKKGKSGLKNWQKRWFVLEGSRLIW 34 APITRQGYLYKKGKSGLKNWQKRWFVLEGS+LIW Sbjct: 527 APITRQGYLYKKGKSGLKNWQKRWFVLEGSKLIW 560
BLAST of mRNA_L-elsbetiae_contig16676.4500.1 vs. uniprot
Match: A0A835ZKA0_9STRA (LISK family protein kinase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZKA0_9STRA) HSP 1 Score: 68.2 bits (165), Expect = 2.130e-12 Identity = 27/34 (79.41%), Postives = 33/34 (97.06%), Query Frame = 0 Query: 1 APITRQGYLYKKGKSGLKNWQKRWFVLEGSRLIW 34 APIT+ GYL+KKGK+GLKNWQ+RWFVLEG++LIW Sbjct: 414 APITKCGYLHKKGKTGLKNWQRRWFVLEGTKLIW 447
BLAST of mRNA_L-elsbetiae_contig16676.4500.1 vs. uniprot
Match: A0A3B3ZJ74_9GOBI (PH domain-containing protein n=1 Tax=Periophthalmus magnuspinnatus TaxID=409849 RepID=A0A3B3ZJ74_9GOBI) HSP 1 Score: 48.1 bits (113), Expect = 6.150e-6 Identity = 19/34 (55.88%), Postives = 25/34 (73.53%), Query Frame = 0 Query: 1 APITRQGYLYKKGKSGLKNWQKRWFVLEGSRLIW 34 A +T+QG+LYK+G SG+K W KRWFVL L + Sbjct: 53 AVVTKQGWLYKQGSSGVKQWNKRWFVLTDRCLFY 86
BLAST of mRNA_L-elsbetiae_contig16676.4500.1 vs. uniprot
Match: UPI000A1C46D1 (pleckstrin homology domain-containing family A member 6 n=4 Tax=Oxudercinae TaxID=497678 RepID=UPI000A1C46D1) HSP 1 Score: 48.1 bits (113), Expect = 2.460e-5 Identity = 19/34 (55.88%), Postives = 25/34 (73.53%), Query Frame = 0 Query: 1 APITRQGYLYKKGKSGLKNWQKRWFVLEGSRLIW 34 A +T+QG+LYK+G SG+K W KRWFVL L + Sbjct: 104 AVVTKQGWLYKQGSSGVKQWNKRWFVLTDRCLFY 137
BLAST of mRNA_L-elsbetiae_contig16676.4500.1 vs. uniprot
Match: UPI00155E2083 (pleckstrin homology domain-containing family A member 6 isoform X1 n=60 Tax=Percidae TaxID=8165 RepID=UPI00155E2083) HSP 1 Score: 47.8 bits (112), Expect = 3.360e-5 Identity = 18/34 (52.94%), Postives = 25/34 (73.53%), Query Frame = 0 Query: 1 APITRQGYLYKKGKSGLKNWQKRWFVLEGSRLIW 34 AP+++QG+LYK+ SG+K W KRWFVL L + Sbjct: 104 APVSKQGWLYKQASSGVKQWNKRWFVLADRCLFY 137
BLAST of mRNA_L-elsbetiae_contig16676.4500.1 vs. uniprot
Match: UPI00155F457E (pleckstrin homology domain-containing family A member 6 isoform X17 n=2 Tax=Percidae TaxID=8165 RepID=UPI00155F457E) HSP 1 Score: 47.8 bits (112), Expect = 3.360e-5 Identity = 18/34 (52.94%), Postives = 25/34 (73.53%), Query Frame = 0 Query: 1 APITRQGYLYKKGKSGLKNWQKRWFVLEGSRLIW 34 AP+++QG+LYK+ SG+K W KRWFVL L + Sbjct: 104 APVSKQGWLYKQASSGVKQWNKRWFVLADRCLFY 137
BLAST of mRNA_L-elsbetiae_contig16676.4500.1 vs. uniprot
Match: A0A6A4SS30_SCOMX (PH domain-containing protein n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A6A4SS30_SCOMX) HSP 1 Score: 47.0 bits (110), Expect = 6.290e-5 Identity = 18/34 (52.94%), Postives = 24/34 (70.59%), Query Frame = 0 Query: 1 APITRQGYLYKKGKSGLKNWQKRWFVLEGSRLIW 34 A +T+QG+LYK+ SG+K W KRWFVL L + Sbjct: 174 AEVTKQGWLYKQASSGVKQWNKRWFVLADRSLFY 207
BLAST of mRNA_L-elsbetiae_contig16676.4500.1 vs. uniprot
Match: A0A8D2ZFF5_SCOMX (PH domain-containing protein n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A8D2ZFF5_SCOMX) HSP 1 Score: 47.0 bits (110), Expect = 6.290e-5 Identity = 18/34 (52.94%), Postives = 24/34 (70.59%), Query Frame = 0 Query: 1 APITRQGYLYKKGKSGLKNWQKRWFVLEGSRLIW 34 A +T+QG+LYK+ SG+K W KRWFVL L + Sbjct: 99 AEVTKQGWLYKQASSGVKQWNKRWFVLADRSLFY 132
BLAST of mRNA_L-elsbetiae_contig16676.4500.1 vs. uniprot
Match: UPI001FA8D0E4 (pleckstrin homology domain-containing family A member 6 isoform X14 n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=UPI001FA8D0E4) HSP 1 Score: 47.0 bits (110), Expect = 6.290e-5 Identity = 18/34 (52.94%), Postives = 24/34 (70.59%), Query Frame = 0 Query: 1 APITRQGYLYKKGKSGLKNWQKRWFVLEGSRLIW 34 A +T+QG+LYK+ SG+K W KRWFVL L + Sbjct: 99 AEVTKQGWLYKQASSGVKQWNKRWFVLADRSLFY 132
BLAST of mRNA_L-elsbetiae_contig16676.4500.1 vs. uniprot
Match: UPI001FA8E50F (pleckstrin homology domain-containing family A member 6 isoform X15 n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=UPI001FA8E50F) HSP 1 Score: 47.0 bits (110), Expect = 6.290e-5 Identity = 18/34 (52.94%), Postives = 24/34 (70.59%), Query Frame = 0 Query: 1 APITRQGYLYKKGKSGLKNWQKRWFVLEGSRLIW 34 A +T+QG+LYK+ SG+K W KRWFVL L + Sbjct: 99 AEVTKQGWLYKQASSGVKQWNKRWFVLADRSLFY 132 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig16676.4500.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig16676.4500.1 ID=prot_L-elsbetiae_contig16676.4500.1|Name=mRNA_L-elsbetiae_contig16676.4500.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=35bpback to top |