prot_L-elsbetiae_contig15165.3692.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15165.3692.1 vs. uniprot
Match: D7FW12_ECTSI (Cyclic nucleotide-binding domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FW12_ECTSI) HSP 1 Score: 72.0 bits (175), Expect = 2.200e-12 Identity = 38/54 (70.37%), Postives = 45/54 (83.33%), Query Frame = 0 Query: 1 EDDEAIKQHAERIVSTYISPTALGVPAALIYTSEEQRKALTAKMKRLWRKDRPK 54 EDDEA KQHAERIV++YISP++ GVP LIYTSE QR AL AKM+RLW K +P+ Sbjct: 254 EDDEARKQHAERIVASYISPSSSGVPG-LIYTSEAQRNALAAKMRRLWPKHKPR 306
BLAST of mRNA_L-elsbetiae_contig15165.3692.1 vs. uniprot
Match: A0A6H5JLV2_9PHAE (Cyclic nucleotide-binding domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLV2_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 8.580e-8 Identity = 31/45 (68.89%), Postives = 39/45 (86.67%), Query Frame = 0 Query: 1 EDDEAIKQHAERIVSTYISPTALGVPAALIYTSEEQRKALTAKMK 45 ED+EA KQHAERIV++YISP++ GVP+ +IYTSE QR AL AKM+ Sbjct: 285 EDNEARKQHAERIVASYISPSSSGVPS-MIYTSEAQRNALAAKMR 328 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15165.3692.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig15165.3692.1 ID=prot_L-elsbetiae_contig15165.3692.1|Name=mRNA_L-elsbetiae_contig15165.3692.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=112bpback to top |