mRNA_L-elsbetiae_contig14839.3498.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig14839.3498.1 vs. uniprot
Match: A0A6H5JW94_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JW94_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 8.810e-6 Identity = 24/38 (63.16%), Postives = 28/38 (73.68%), Query Frame = 1 Query: 118 EKKCAYHRGCAKQPSFGVAGSKKAEFCCEHKKVGMVNV 231 +K+C H GC K+PSFG AGSK+AEFCC H K MV V Sbjct: 6 DKRCG-HPGCTKKPSFGTAGSKRAEFCCPHAKQDMVIV 42
BLAST of mRNA_L-elsbetiae_contig14839.3498.1 vs. uniprot
Match: D7FY22_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FY22_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 1.110e-5 Identity = 25/45 (55.56%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 115 KEKKCAYHRGCAKQPSFGVAGSKKAEFCCEHKKVGMVNVKKYKRC 249 K ++C GC +PS+G+ GSKKAEFC +H K GM NV K KRC Sbjct: 26 KGQRCCQEHGCTARPSYGIDGSKKAEFCSKHSKPGMTNVTK-KRC 69 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig14839.3498.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig14839.3498.1 >prot_L-elsbetiae_contig14839.3498.1 ID=prot_L-elsbetiae_contig14839.3498.1|Name=mRNA_L-elsbetiae_contig14839.3498.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=116bp MTPRKEKKCAYHRGCAKQPSFGVAGSKKAEFCCEHKKVGMVNVKKYKRCNback to top mRNA from alignment at L-elsbetiae_contig14839:1724..2173+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig14839.3498.1 ID=mRNA_L-elsbetiae_contig14839.3498.1|Name=mRNA_L-elsbetiae_contig14839.3498.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=450bp|location=Sequence derived from alignment at L-elsbetiae_contig14839:1724..2173+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig14839:1724..2173+ >mRNA_L-elsbetiae_contig14839.3498.1 ID=mRNA_L-elsbetiae_contig14839.3498.1|Name=mRNA_L-elsbetiae_contig14839.3498.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=696bp|location=Sequence derived from alignment at L-elsbetiae_contig14839:1724..2173+ (Laminarionema elsbetiae ELsaHSoW15)back to top |