prot_L-elsbetiae_contig10297.340.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig10297.340.1 vs. uniprot
Match: A0A4S8KW60_DENBC (3'-5' exonuclease domain-containing protein n=1 Tax=Dendrothele bispora (strain CBS 962.96) TaxID=1314807 RepID=A0A4S8KW60_DENBC) HSP 1 Score: 69.3 bits (168), Expect = 1.460e-10 Identity = 41/146 (28.08%), Postives = 71/146 (48.63%), Query Frame = 0 Query: 30 HPGVLKRLPRDLLELFPAVILRKSAVDKKLITRVEQTLVNPIGLKTLANNVRENHMRHYLWLQLRYYARMGRRRRHGQSSAVPAENELMTKPPRFSRFDDQAGYNGRPPSASVLQSAFVAVMEGMEHWYHRQQQLVDGRNLGLDDS 175 HP +LK+LP DL + FPA + +S +DK L+ + + + + + +RE H+R + L+LRY + ++++ + N TK FS FDD+ Y G PS + + ++ ME + + + G L D S Sbjct: 26 HPDILKQLPPDLADEFPAFLTHRSGIDKGLLALIRAGVAHRVSSNAWEDILRELHLREHDILELRYLHSIQDQQKYNEKW-----NIAQTKYIPFSAFDDRTQYAGHAPSKRYINNVYMDFMESIRSCLDQCMSALTGHILQWDHS 166 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig10297.340.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig10297.340.1 ID=prot_L-elsbetiae_contig10297.340.1|Name=mRNA_L-elsbetiae_contig10297.340.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=175bpback to top |