prot_L-elsbetiae_contig14276.3172.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig14276.3172.1 vs. uniprot
Match: UPI0004596B05 (nitronate monooxygenase n=1 Tax=Bordetella bronchiseptica TaxID=518 RepID=UPI0004596B05) HSP 1 Score: 49.7 bits (117), Expect = 9.480e-6 Identity = 22/25 (88.00%), Postives = 24/25 (96.00%), Query Frame = 0 Query: 1 NDTATTEIYTLSLHDALPICVFSAG 25 NDTATTEIYTLSLHDALPIC+ +AG Sbjct: 5 NDTATTEIYTLSLHDALPICIAAAG 29
BLAST of mRNA_L-elsbetiae_contig14276.3172.1 vs. uniprot
Match: UPI001F402FF6 (integrase core domain-containing protein n=1 Tax=Bordetella holmesii TaxID=35814 RepID=UPI001F402FF6) HSP 1 Score: 47.0 bits (110), Expect = 1.480e-5 Identity = 24/43 (55.81%), Postives = 27/43 (62.79%), Query Frame = 0 Query: 1 NDTATTEIYTLSLHDALPICVFSAGFVGFGGMYVHILSPSPHQ 43 NDTATTEIYTLSLHDALPIC + + Y H S H+ Sbjct: 1 NDTATTEIYTLSLHDALPICFIQSALREWA--YAHTYQNSQHR 41
BLAST of mRNA_L-elsbetiae_contig14276.3172.1 vs. uniprot
Match: A0A357VKS7_9FIRM (Uncharacterized protein (Fragment) n=1 Tax=Peptococcaceae bacterium TaxID=2052179 RepID=A0A357VKS7_9FIRM) HSP 1 Score: 46.6 bits (109), Expect = 3.180e-5 Identity = 27/46 (58.70%), Postives = 29/46 (63.04%), Query Frame = 0 Query: 1 NDTATTEIYTLSLHDALPICV-----FSAGFVGFGGMYVHILSPSP 41 NDTATTEIYTLSLHDALPI + S+G GFG H S P Sbjct: 6 NDTATTEIYTLSLHDALPIYIQPGLALSSGEGGFGPFPKHSGSQQP 51
BLAST of mRNA_L-elsbetiae_contig14276.3172.1 vs. uniprot
Match: X1Q312_9ZZZZ (Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1Q312_9ZZZZ) HSP 1 Score: 45.1 bits (105), Expect = 3.380e-5 Identity = 20/20 (100.00%), Postives = 20/20 (100.00%), Query Frame = 0 Query: 1 NDTATTEIYTLSLHDALPIC 20 NDTATTEIYTLSLHDALPIC Sbjct: 4 NDTATTEIYTLSLHDALPIC 23
BLAST of mRNA_L-elsbetiae_contig14276.3172.1 vs. uniprot
Match: UPI001CC4E4FB (hypothetical protein n=1 Tax=Burkholderia diffusa TaxID=488732 RepID=UPI001CC4E4FB) HSP 1 Score: 45.1 bits (105), Expect = 5.840e-5 Identity = 20/20 (100.00%), Postives = 20/20 (100.00%), Query Frame = 0 Query: 1 NDTATTEIYTLSLHDALPIC 20 NDTATTEIYTLSLHDALPIC Sbjct: 6 NDTATTEIYTLSLHDALPIC 25
BLAST of mRNA_L-elsbetiae_contig14276.3172.1 vs. uniprot
Match: UPI0006645EA1 (hypothetical protein n=1 Tax=Pedobacter sp. V48 TaxID=509635 RepID=UPI0006645EA1) HSP 1 Score: 45.1 bits (105), Expect = 6.820e-5 Identity = 23/39 (58.97%), Postives = 25/39 (64.10%), Query Frame = 0 Query: 1 NDTATTEIYTLSLHDALPICVFSAGFVGFGGMYVHILSP 39 NDTATTEIYTLSLHDALPI + GG+ H P Sbjct: 12 NDTATTEIYTLSLHDALPISMI------IGGLVYHTFGP 44 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig14276.3172.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 6
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig14276.3172.1 ID=prot_L-elsbetiae_contig14276.3172.1|Name=mRNA_L-elsbetiae_contig14276.3172.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=48bpback to top |