mRNA_L-elsbetiae_contig13901.2934.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13901.2934.1 vs. uniprot
Match: D8LDN9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDN9_ECTSI) HSP 1 Score: 87.8 bits (216), Expect = 1.390e-16 Identity = 42/76 (55.26%), Postives = 59/76 (77.63%), Query Frame = 2 Query: 155 GFCLLFVATVLLALMCVSLLTNKAAQNMASWTFHGNNKIGAIVGLVLCGSVPVSLFVWERYRSRELERLVEEFPPV 382 FC + +A LL +MC++LLTN+AAQNMA+WTF G++++GAI+GLVLC VP+SLFVW+ +S +L R + E P V Sbjct: 437 SFCFV-LAAALLFIMCITLLTNEAAQNMAAWTFEGDHRVGAIIGLVLCTCVPLSLFVWKCRKSGKLLRSIRECPLV 511
BLAST of mRNA_L-elsbetiae_contig13901.2934.1 vs. uniprot
Match: A0A6H5KRC3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRC3_9PHAE) HSP 1 Score: 76.6 bits (187), Expect = 8.340e-13 Identity = 41/81 (50.62%), Postives = 56/81 (69.14%), Query Frame = 2 Query: 143 RGQCGFCLLFVATVLLALMCVSLLTNKAAQNMASWTFHGNNKIGAIVGLVLCGSVPVSLFVWERYRSRELERLVEEFPPVD 385 R FCL+ +A V+L MCV+LLTN+AAQ+MA WTF G+ +IGA+VGL+L VP+S F W S +L RLV++ P + Sbjct: 326 RSCASFCLV-LAAVMLVTMCVALLTNEAAQHMAEWTFEGDYRIGAVVGLMLRSCVPLS-FAWNYRNSNKLFRLVKDCPVAE 404 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13901.2934.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig13901.2934.1 >prot_L-elsbetiae_contig13901.2934.1 ID=prot_L-elsbetiae_contig13901.2934.1|Name=mRNA_L-elsbetiae_contig13901.2934.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=137bp MEYSGGFCADWPAGKRCCLWASFARTGSPASTRSFVCPVHGSLCRQNRGQback to top mRNA from alignment at L-elsbetiae_contig13901:1414..2324+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig13901.2934.1 ID=mRNA_L-elsbetiae_contig13901.2934.1|Name=mRNA_L-elsbetiae_contig13901.2934.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=911bp|location=Sequence derived from alignment at L-elsbetiae_contig13901:1414..2324+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig13901:1414..2324+ >mRNA_L-elsbetiae_contig13901.2934.1 ID=mRNA_L-elsbetiae_contig13901.2934.1|Name=mRNA_L-elsbetiae_contig13901.2934.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=822bp|location=Sequence derived from alignment at L-elsbetiae_contig13901:1414..2324+ (Laminarionema elsbetiae ELsaHSoW15)back to top |