prot_L-elsbetiae_contig13901.2934.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13901.2934.1 vs. uniprot
Match: D8LDN9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDN9_ECTSI) HSP 1 Score: 88.2 bits (217), Expect = 1.060e-17 Identity = 45/83 (54.22%), Postives = 62/83 (74.70%), Query Frame = 0 Query: 52 GFCLLFVATVLLALMCVSLLTNKAAQNMASWTFHGNNKIGAIVGLVLCGSVPVSLFVWERYRSRELERLVEEFPPVDPELDRA 134 FC + +A LL +MC++LLTN+AAQNMA+WTF G++++GAI+GLVLC VP+SLFVW+ +S +L R + E P V E DR Sbjct: 437 SFCFV-LAAALLFIMCITLLTNEAAQNMAAWTFEGDHRVGAIIGLVLCTCVPLSLFVWKCRKSGKLLRSIRECPLV-AESDRV 517
BLAST of mRNA_L-elsbetiae_contig13901.2934.1 vs. uniprot
Match: A0A6H5KRC3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRC3_9PHAE) HSP 1 Score: 76.6 bits (187), Expect = 1.040e-13 Identity = 41/81 (50.62%), Postives = 56/81 (69.14%), Query Frame = 0 Query: 48 RGQCGFCLLFVATVLLALMCVSLLTNKAAQNMASWTFHGNNKIGAIVGLVLCGSVPVSLFVWERYRSRELERLVEEFPPVD 128 R FCL+ +A V+L MCV+LLTN+AAQ+MA WTF G+ +IGA+VGL+L VP+S F W S +L RLV++ P + Sbjct: 326 RSCASFCLV-LAAVMLVTMCVALLTNEAAQHMAEWTFEGDYRIGAVVGLMLRSCVPLS-FAWNYRNSNKLFRLVKDCPVAE 404 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13901.2934.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig13901.2934.1 ID=prot_L-elsbetiae_contig13901.2934.1|Name=mRNA_L-elsbetiae_contig13901.2934.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=137bpback to top |