prot_L-elsbetiae_contig13847.2901.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13847.2901.1 vs. uniprot
Match: A0A6H5K5T4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K5T4_9PHAE) HSP 1 Score: 85.1 bits (209), Expect = 7.620e-18 Identity = 45/122 (36.89%), Postives = 66/122 (54.10%), Query Frame = 0 Query: 34 ESEGMREVDAALRRMFPEEARKPAVLFYDLACRYRDYLRKIKILFWLGTLLVVDRLHFKAHRQLRCAEFCSPNHTANSMLWHAGEDGSPVFNHNSSMAESTNAWIPGFQLIVMRTEAALGQW 155 E+EG EVDA L+++ P+E R+P + FYD A + YL + L W+ T+L+V + + L C+ F SPN N +LW+ ++ P F NSSM ES N W+ G E +W Sbjct: 7 EAEGCAEVDAVLKKIVPDEDRRPTIFFYDTAYLFDRYLSRRGDLSWVATMLIVQ---YWGRKGLLCSLFNSPNDDDNPLLWNV-QEAPPEFYWNSSMGESNNGWLSGSPRETEEEEGHTARW 124 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13847.2901.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig13847.2901.1 ID=prot_L-elsbetiae_contig13847.2901.1|Name=mRNA_L-elsbetiae_contig13847.2901.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=163bpback to top |