prot_L-elsbetiae_contig13808.2880.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13808.2880.1 vs. uniprot
Match: D8LRE4_ECTSI (Centrosomal protein of 162 kDa n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LRE4_ECTSI) HSP 1 Score: 98.2 bits (243), Expect = 1.350e-22 Identity = 54/58 (93.10%), Postives = 56/58 (96.55%), Query Frame = 0 Query: 1 MERRTARREAELERVLSESRQQSKLELSRLRALHADEMGAKDALVHGFRVELDGLLRA 58 MERRTARREAEL+RVLSESRQQSKLELSRLRA+HADEM AKDALVHGFR ELDGLLRA Sbjct: 408 MERRTARREAELQRVLSESRQQSKLELSRLRAIHADEMRAKDALVHGFRAELDGLLRA 465
BLAST of mRNA_L-elsbetiae_contig13808.2880.1 vs. uniprot
Match: A0A6H5KNC7_9PHAE (Centrosomal protein of 162 kDa (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KNC7_9PHAE) HSP 1 Score: 98.2 bits (243), Expect = 1.630e-22 Identity = 54/58 (93.10%), Postives = 56/58 (96.55%), Query Frame = 0 Query: 1 MERRTARREAELERVLSESRQQSKLELSRLRALHADEMGAKDALVHGFRVELDGLLRA 58 MERRTARREAEL+RVLSESRQQSKLELSRLRA+HADEM AKDALVHGFR ELDGLLRA Sbjct: 640 MERRTARREAELQRVLSESRQQSKLELSRLRAIHADEMRAKDALVHGFRAELDGLLRA 697 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13808.2880.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig13808.2880.1 ID=prot_L-elsbetiae_contig13808.2880.1|Name=mRNA_L-elsbetiae_contig13808.2880.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=58bpback to top |